EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03831 - PhnA)
FAM  PF03831
PID  PhnA
DES  PhnA protein
IPR  IPR004624
ANO  14
ALN  59
AID  0.601645
APH  (((((Q9FB32_9ACTO/47-103:0.24116,Q9I704_PSEAE/45-99:0.14305):0.13082,((((Q9CP95_PASMU/43-97:0.07223,O25540_HELPY/42-96:0.23981):0.05099,(PHNA_HAEIN/57-108:0.06004,Q9RF97_HAEDU/44-95:0.02232):0.08972):0.09612,PHNA_ECOLI/43-97:0.07972):0.07746,((Q99ZD4_STRPY/43-97:0.06924,Q9CDH5_LACLA/43-100:0.62199):0.08958,Q97PK7_STRPN/44-98:0.04797):0.15991):0.01439):0.12823,Q9JWN4_NEIMA/42-96:0.10516):0.18089,Q9KM40_VIBCH/124-178:0.42601):0.23167,Q9A438_CAUCR/4-59:0.22090,Q9PIU4_CAMJE/1-55:0.39934);
ATP  (((((Q9FB32_9ACTO/47-103,Q9I704_PSEAE/45-99),((((Q9CP95_PASMU/43-97,O25540_HELPY/42-96),(PHNA_HAEIN/57-108,Q9RF97_HAEDU/44-95)),PHNA_ECOLI/43-97),((Q99ZD4_STRPY/43-97,Q9CDH5_LACLA/43-100),Q97PK7_STRPN/44-98))),Q9JWN4_NEIMA/42-96),Q9KM40_VIBCH/124-178),Q9A438_CAUCR/4-59,Q9PIU4_CAMJE/1-55);
ATL  4.09778
DNO  14
DLN  177
DID  0.571853
DPH  (((((Q9FB32_9ACTO/47-103:0.20395,Q9I704_PSEAE/45-99:0.08353):0.10126,((((PHNA_HAEIN/57-108:0.10957,Q9RF97_HAEDU/44-95:0.13694):0.09447,(Q9CP95_PASMU/43-97:0.10357,O25540_HELPY/42-96:0.26764):0.08333):0.08902,((Q97PK7_STRPN/44-98:0.13102,Q9CDH5_LACLA/43-100:0.57559):0.04085,Q99ZD4_STRPY/43-97:0.14843):0.13979):0.11887,PHNA_ECOLI/43-97:0.09923):0.10696):0.07931,Q9JWN4_NEIMA/42-96:0.21887):0.19833,Q9A438_CAUCR/4-59:0.17246):0.18596,Q9KM40_VIBCH/124-178:0.36937,Q9PIU4_CAMJE/1-55:0.52523);
DTP  (((((Q9FB32_9ACTO/47-103,Q9I704_PSEAE/45-99),((((PHNA_HAEIN/57-108,Q9RF97_HAEDU/44-95),(Q9CP95_PASMU/43-97,O25540_HELPY/42-96)),((Q97PK7_STRPN/44-98,Q9CDH5_LACLA/43-100),Q99ZD4_STRPY/43-97)),PHNA_ECOLI/43-97)),Q9JWN4_NEIMA/42-96),Q9A438_CAUCR/4-59),Q9KM40_VIBCH/124-178,Q9PIU4_CAMJE/1-55);
DTL  4.38356
RID  0.601645
RPH  (((((Q9FB32_9ACTO/47-103:0.24116,Q9I704_PSEAE/45-99:0.14305):0.13082,((((Q9CP95_PASMU/43-97:0.07223,O25540_HELPY/42-96:0.23981):0.05099,(PHNA_HAEIN/57-108:0.06004,Q9RF97_HAEDU/44-95:0.02232):0.08972):0.09612,PHNA_ECOLI/43-97:0.07972):0.07746,((Q99ZD4_STRPY/43-97:0.06924,Q9CDH5_LACLA/43-100:0.62199):0.08958,Q97PK7_STRPN/44-98:0.04797):0.15991):0.01439):0.12823,Q9JWN4_NEIMA/42-96:0.10516):0.18089,Q9KM40_VIBCH/124-178:0.42601):0.23167,Q9A438_CAUCR/4-59:0.22090,Q9PIU4_CAMJE/1-55:0.39934);
RTP  (((((Q9FB32_9ACTO/47-103,Q9I704_PSEAE/45-99),((((Q9CP95_PASMU/43-97,O25540_HELPY/42-96),(PHNA_HAEIN/57-108,Q9RF97_HAEDU/44-95)),PHNA_ECOLI/43-97),((Q99ZD4_STRPY/43-97,Q9CDH5_LACLA/43-100),Q97PK7_STRPN/44-98))),Q9JWN4_NEIMA/42-96),Q9KM40_VIBCH/124-178),Q9A438_CAUCR/4-59,Q9PIU4_CAMJE/1-55);
RTL  4.09778
LNK  O25540_HELPY/42-96:O25540:AE000597
LNK  PHNA_ECOLI/43-97:P16680:U14003
LNK  PHNA_HAEIN/57-108:P44479:U32690
LNK  Q97PK7_STRPN/44-98:Q97PK7:AE007454
LNK  Q99ZD4_STRPY/43-97:Q99ZD4:AE006566
LNK  Q9A438_CAUCR/4-59:Q9A438:AE005963
LNK  Q9CDH5_LACLA/43-100:Q9CDH5:AE006453
LNK  Q9CP95_PASMU/43-97:Q9CP95:AE006050
LNK  Q9FB32_9ACTO/47-103:Q9FB32:AF210249
LNK  Q9I704_PSEAE/45-99:Q9I704:AE004450
LNK  Q9JWN4_NEIMA/42-96:Q9JWN4:AL162752
LNK  Q9KM40_VIBCH/124-178:Q9KM40:AE004385
LNK  Q9PIU4_CAMJE/1-55:Q9PIU4:AL139074
LNK  Q9RF97_HAEDU/44-95:Q9RF97:AF200362
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9CDH5_LACLA/43-100
ASQ  IVLDSLGNELETGDDLVIVQDLPVKGMP.KPIKQGTKVKNIRINPEGKNEHFIDSKIPG
DSQ  ATTGTCCTTGATAGTTTAGGAAATGAGTTAGAAACTGGGGATGACCTTGTTATTGTGCAAGATTTGCCAGTTAAGGGAATGCCA...AAACCAATTAAGCAGGGAACAAAAGTGAAAAACATTCGCATTAATCCAGAAGGGAAAAATGAACATTTTATTGATTCAAAAATTCCGGGC
TRN  11011101111011000
NAM  Q9I704_PSEAE/45-99
ASQ  VIKDSVGNVLQDGDTITVIKDLKVKGSS.LVVKVGTKVKNIRL-VDG--DHDIDCKIDG
DSQ  GTGATCAAGGATTCGGTGGGCAACGTTCTCCAGGACGGCGATACCATCACCGTGATCAAGGACCTGAAAGTGAAAGGCTCCTCG...CTGGTGGTGAAGGTCGGCACCAAGGTGAAGAACATCCGCTTG---GTGGACGGC------GACCACGACATCGATTGCAAGATCGACGGC
TRN  11011101101011011
NAM  Q9FB32_9ACTO/47-103
ASQ  AIRDAVGNVLADGDTVTVVKSLKVKGHP.TGIKAGTKVRNIRL-VEGVAGHDIDCKIDG
DSQ  GCGATCAGGGACGCGGTCGGCAACGTACTCGCCGACGGCGACACCGTCACGGTGGTCAAGAGCCTGAAGGTCAAGGGCCACCCG...ACCGGCATCAAGGCCGGCACCAAGGTGCGCAACATCCGCCTC---GTGGAGGGTGTGGCCGGCCACGACATCGACTGCAAGATCGACGGG
TRN  10010101100011011
NAM  Q97PK7_STRPN/44-98
ASQ  VAIDANGNKLADGDTVTLIKDLKVKGAP.KDLKQGTRVKNIRI-VEG--DHNIDCKIDG
DSQ  GTCGCTATCGATGCCAACGGAAATAAATTGGCTGATGGTGATACAGTAACTCTCATCAAGGACTTGAAAGTAAAAGGTGCGCCA...AAAGATTTGAAACAAGGGACGCGCGTGAAAAATATCCGCATC---GTAGAAGGC------GACCACAATATCGACTGTAAGATTGATGGT
TRN  11011101111011011
NAM  Q99ZD4_STRPY/43-97
ASQ  VVLDSNGVRLSDGDTITVVKDLKVKGAP.KDLKQGTRVKNIRL-VEG--DHNIDCKIDG
DSQ  GTTGTTTTGGATAGCAATGGTGTCCGACTGTCTGATGGTGATACCATTACTGTGGTTAAAGATTTGAAAGTAAAAGGCGCTCCA...AAAGACCTGAAACAAGGGACTCGAGTTAAAAATATTCGCCTG---GTGGAAGGT------GATCATAATATTGATTGTAAGATTGATGGG
TRN  11011101101011011
NAM  O25540_HELPY/42-96
ASQ  IVKDCHNNLLQNGDSVILIKDLKVKNSS.LVLKKGTKIKNTKL-VNS--DHNVDCKIEG
DSQ  ATCGTTAAAGATTGCCACAATAATCTTTTACAAAATGGGGACTCGGTCATTCTCATTAAGGATTTAAAGGTTAAAAACTCATCT...TTAGTGCTTAAAAAAGGCACCAAAATCAAAAATACCAAGCTT---GTCAATAGC------GATCACAATGTGGATTGTAAAATAGAAGGG
TRN  10010101110011000
NAM  PHNA_ECOLI/43-97
ASQ  IVKDANGNLLADGDSVTIIKDLKVKGSS.SMLKIGTKVKNIRL-VEG--DHNIDCKIDG
DSQ  ATCGTTAAAGATGCTAACGGCAATCTGCTGGCTGACGGCGACAGCGTTACCATCATTAAAGATCTGAAGGTGAAAGGTAGCTCT...TCGATGCTGAAAATTGGCACCAAAGTGAAAAACATCCGCCTG---GTTGAAGGC------GACCATAACATCGATTGCAAAATCGACGGT
TRN  11011101101011011
NAM  Q9CP95_PASMU/43-97
ASQ  VVKDSNGNLLQDGDSVILIKDLKVKGSS.IVLKKGTKAKNIRL-VDA--DHDVDCKIDG
DSQ  GTGGTGAAAGACAGCAACGGTAATCTTCTACAAGATGGTGATTCGGTTATCTTAATTAAAGATCTCAAAGTAAAAGGCTCGTCT...ATCGTGTTAAAGAAAGGCACCAAAGCCAAAAACATTCGTTTA---GTCGATGCC------GATCATGATGTTGATTGCAAAATTGATGGG
TRN  11011101111011010
NAM  Q9RF97_HAEDU/44-95
ASQ  IVKDSNGNLLADGDSVLLIKDLKLKGSS.EVLKKGTKFKGIRL-VDG--DHNVDC---G
DSQ  ATCGTTAAAGACAGTAATGGCAACTTATTAGCCGATGGCGATAGCGTATTATTAATCAAAGATCTAAAATTAAAAGGCTCATCA...GAAGTGTTAAAAAAAGGAACCAAATTTAAAGGTATCCGTTTA---GTAGATGGC------GACCACAATGTAGATTGT---------GGC
TRN  11011101111011000
NAM  PHNA_HAEIN/57-108
ASQ  IVKDSNGNLLAEGDNVLLIKDLKLKGSS.EVLKKGTKFKNIRL-VNG--DHNVDC---G
DSQ  ATCGTAAAAGACAGCAATGGGAATTTGCTTGCAGAAGGCGACAATGTACTTTTGATTAAAGATTTAAAATTAAAAGGTTCATCA...GAAGTATTGAAAAAAGGTACAAAATTCAAAAACATCCGCTTA---GTAAATGGC------GATCATAATGTCGATTGC---------GGC
TRN  11011101111011000
NAM  Q9JWN4_NEIMA/42-96
ASQ  QVRDANGAALQNGDTVILIKDLKVKGSS.MVIKQGTKVKGIRL-QEG--DHNISCKIDG
DSQ  CAAGTGCGCGATGCCAACGGCGCGGCACTGCAAAACGGCGATACCGTCATCCTCATCAAAGACCTCAAGGTAAAAGGCAGCTCG...ATGGTGATCAAACAAGGTACGAAAGTCAAAGGCATACGCCTG---CAGGAAGGC------GATCACAACATCAGCTGCAAAATCGACGGC
TRN  10010101100011011
NAM  Q9PIU4_CAMJE/1-55
ASQ  MAKDANGIELNAGDSVSIIKDLKVKGAS.TTLKRGTTIKNIKLTSKE---GEIEARVDK
DSQ  ATGGCTAAAGACGCTAATGGAATAGAACTTAACGCAGGTGATAGCGTGAGTATAATAAAAGATCTTAAGGTTAAAGGTGCAAGT...ACAACTTTAAAACGTGGAACTACTATAAAAAATATTAAGCTCACTTCTAAAGAA---------GGTGAAATTGAGGCTAGAGTAGATAAA
TRN  10010101110011010
NAM  Q9A438_CAUCR/4-59
ASQ  ETRDSNGTLLADGDTVTLIKDLKVKGSGgVTLKRGTVVKKIRLTGDP---DEIEANVDK
DSQ  GAAACCCGCGACTCGAACGGAACCCTGCTGGCCGACGGCGACACCGTCACCCTGATCAAGGACCTCAAGGTCAAGGGCTCGGGCggcGTGACGCTGAAGCGCGGCACGGTGGTCAAGAAGATCCGCCTGACCGGCGACCCC---------GATGAGATCGAGGCTAATGTCGACAAG
TRN  11011111101111111
NAM  Q9KM40_VIBCH/124-178
ASQ  KPRDVNGVELKKGDDVTVIKDLPVKGSS.MVIKQGTAVRGIALTEDP---KHIQGKVNG
DSQ  AAACCACGCGATGTAAATGGTGTCGAGCTGAAAAAAGGTGACGATGTCACCGTCATCAAAGATCTACCAGTCAAAGGCTCAAGC...ATGGTCATCAAACAAGGTACTGCAGTACGCGGTATCGCGTTAACCGAAGATCCA---------AAGCACATTCAAGGTAAGGTGAACGGC
TRN  11011101101011000
//