EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03822 - NAF)
FAM  PF03822
PID  NAF
DES  NAF domain
IPR  IPR004041
ANO  24
ALN  64
AID  0.410041
APH  (((((((((O24180_ORYSA/310-369:0.34082,CIPKF_ARATH/300-359:0.32936):0.06351,(O82051_SORBI/310-369:0.40739,(Q9LYQ8_ARATH/310-369:0.14585,Q9LVL3_ARATH/308-366:0.16018):0.11207):0.05686):0.13771,Q9SEG2_MAIZE/384-441:0.50105):0.01489,((Q9XFJ3_MESCR/330-391:0.23077,O65554_ARATH/311-372:0.25196):0.31944,(Q9FJ54_ARATH/298-358:0.33128,Q9LWM4_ORYSA/311-371:0.21307):0.11713):0.04757):0.16824,((Q9MAM1_ARATH/315-376:0.30824,((Q9ZVD9_ARATH/308-368:0.24212,O24342_SORBI/307-367:0.10904):0.18616,Q9C753_ARATH/327-388:0.23307):0.07575):0.13874,(CPK24_ARATH/306-367:0.18161,Q9STV4_ARATH/303-364:0.42876):0.34225):0.16381):0.24550,((O80902_ARATH/304-364:0.68660,CIPKB_ARATH/303-364:0.43096):0.48249,Q9XIW0_ARATH/303-361:0.53094):0.03632):0.09461,(Q9SEZ7_ARATH/318-377:0.40914,Q9LEU7_ARATH/308-367:0.10032):0.25525):0.18060,Q9FKL0_ARATH/292-352:0.52868):0.23909,CIPK1_ARATH/314-374:0.15934,Q9LGV5_ORYSA/309-369:0.20306);
ATP  (((((((((O24180_ORYSA/310-369,CIPKF_ARATH/300-359),(O82051_SORBI/310-369,(Q9LYQ8_ARATH/310-369,Q9LVL3_ARATH/308-366))),Q9SEG2_MAIZE/384-441),((Q9XFJ3_MESCR/330-391,O65554_ARATH/311-372),(Q9FJ54_ARATH/298-358,Q9LWM4_ORYSA/311-371))),((Q9MAM1_ARATH/315-376,((Q9ZVD9_ARATH/308-368,O24342_SORBI/307-367),Q9C753_ARATH/327-388)),(CPK24_ARATH/306-367,Q9STV4_ARATH/303-364))),((O80902_ARATH/304-364,CIPKB_ARATH/303-364),Q9XIW0_ARATH/303-361)),(Q9SEZ7_ARATH/318-377,Q9LEU7_ARATH/308-367)),Q9FKL0_ARATH/292-352),CIPK1_ARATH/314-374,Q9LGV5_ORYSA/309-369);
ATL  11.0792
DNO  24
DLN  192
DID  0.503755
DPH  ((((((Q9LWM4_ORYSA/311-371:0.22968,(((Q9SEG2_MAIZE/384-441:0.37395,O82051_SORBI/310-369:0.33504):0.08206,(Q9LYQ8_ARATH/310-369:0.11416,Q9LVL3_ARATH/308-366:0.15556):0.16743):0.06578,O24180_ORYSA/310-369:0.31660):0.05991):0.06720,CIPKF_ARATH/300-359:0.24428):0.09105,((Q9XFJ3_MESCR/330-391:0.25216,O65554_ARATH/311-372:0.26870):0.24003,Q9FJ54_ARATH/298-358:0.23224):0.08167):0.07631,((((((CPK24_ARATH/306-367:0.25950,Q9STV4_ARATH/303-364:0.38956):0.22060,Q9C753_ARATH/327-388:0.16802):0.13445,Q9MAM1_ARATH/315-376:0.29035):0.09927,(Q9ZVD9_ARATH/308-368:0.26574,O24342_SORBI/307-367:0.17041):0.08274):0.19486,((CIPK1_ARATH/314-374:0.24828,Q9LGV5_ORYSA/309-369:0.16769):0.09245,Q9FKL0_ARATH/292-352:0.40696):0.14660):0.14120,(Q9SEZ7_ARATH/318-377:0.33289,Q9LEU7_ARATH/308-367:0.18240):0.12740):0.03818):0.14460,Q9XIW0_ARATH/303-361:0.36375):0.17968,O80902_ARATH/304-364:0.41957,CIPKB_ARATH/303-364:0.27041);
DTP  ((((((Q9LWM4_ORYSA/311-371,(((Q9SEG2_MAIZE/384-441,O82051_SORBI/310-369),(Q9LYQ8_ARATH/310-369,Q9LVL3_ARATH/308-366)),O24180_ORYSA/310-369)),CIPKF_ARATH/300-359),((Q9XFJ3_MESCR/330-391,O65554_ARATH/311-372),Q9FJ54_ARATH/298-358)),((((((CPK24_ARATH/306-367,Q9STV4_ARATH/303-364),Q9C753_ARATH/327-388),Q9MAM1_ARATH/315-376),(Q9ZVD9_ARATH/308-368,O24342_SORBI/307-367)),((CIPK1_ARATH/314-374,Q9LGV5_ORYSA/309-369),Q9FKL0_ARATH/292-352)),(Q9SEZ7_ARATH/318-377,Q9LEU7_ARATH/308-367))),Q9XIW0_ARATH/303-361),O80902_ARATH/304-364,CIPKB_ARATH/303-364);
DTL  8.99137
RID  0.410041
RPH  (((((((((O24180_ORYSA/310-369:0.34082,CIPKF_ARATH/300-359:0.32936):0.06351,(O82051_SORBI/310-369:0.40739,(Q9LYQ8_ARATH/310-369:0.14585,Q9LVL3_ARATH/308-366:0.16018):0.11207):0.05686):0.13771,Q9SEG2_MAIZE/384-441:0.50105):0.01489,((Q9XFJ3_MESCR/330-391:0.23077,O65554_ARATH/311-372:0.25196):0.31944,(Q9FJ54_ARATH/298-358:0.33128,Q9LWM4_ORYSA/311-371:0.21307):0.11713):0.04757):0.16824,((Q9MAM1_ARATH/315-376:0.30824,((Q9ZVD9_ARATH/308-368:0.24212,O24342_SORBI/307-367:0.10904):0.18616,Q9C753_ARATH/327-388:0.23307):0.07575):0.13874,(CPK24_ARATH/306-367:0.18161,Q9STV4_ARATH/303-364:0.42876):0.34225):0.16381):0.24550,((O80902_ARATH/304-364:0.68660,CIPKB_ARATH/303-364:0.43096):0.48249,Q9XIW0_ARATH/303-361:0.53094):0.03632):0.09461,(Q9SEZ7_ARATH/318-377:0.40914,Q9LEU7_ARATH/308-367:0.10032):0.25525):0.18060,Q9FKL0_ARATH/292-352:0.52868):0.23909,CIPK1_ARATH/314-374:0.15934,Q9LGV5_ORYSA/309-369:0.20306);
RTP  (((((((((O24180_ORYSA/310-369,CIPKF_ARATH/300-359),(O82051_SORBI/310-369,(Q9LYQ8_ARATH/310-369,Q9LVL3_ARATH/308-366))),Q9SEG2_MAIZE/384-441),((Q9XFJ3_MESCR/330-391,O65554_ARATH/311-372),(Q9FJ54_ARATH/298-358,Q9LWM4_ORYSA/311-371))),((Q9MAM1_ARATH/315-376,((Q9ZVD9_ARATH/308-368,O24342_SORBI/307-367),Q9C753_ARATH/327-388)),(CPK24_ARATH/306-367,Q9STV4_ARATH/303-364))),((O80902_ARATH/304-364,CIPKB_ARATH/303-364),Q9XIW0_ARATH/303-361)),(Q9SEZ7_ARATH/318-377,Q9LEU7_ARATH/308-367)),Q9FKL0_ARATH/292-352),CIPK1_ARATH/314-374,Q9LGV5_ORYSA/309-369);
RTL  11.0792
LNK  CIPK1_ARATH/314-374:Q8RWC9:AF302112
LNK  CIPKB_ARATH/303-364:O22932:AF295666
LNK  CIPKF_ARATH/300-359:P92937:D30622
LNK  CPK24_ARATH/306-367:Q9LDI3:AF237670
LNK  O24180_ORYSA/310-369:O24180:AF004947
LNK  O24342_SORBI/307-367:O24342:Y12464
LNK  O65554_ARATH/311-372:O65554:AL022198
LNK  O80902_ARATH/304-364:O80902:AC005499
LNK  O82051_SORBI/310-369:O82051:Y14274
LNK  Q9C753_ARATH/327-388:Q9C753:AC073506
LNK  Q9FJ54_ARATH/298-358:Q9FJ54:AB016870
LNK  Q9FKL0_ARATH/292-352:Q9FKL0:AB011482
LNK  Q9LEU7_ARATH/308-367:Q9LEU7:AL365234
LNK  Q9LGV5_ORYSA/309-369:Q9LGV5:AP002482
LNK  Q9LVL3_ARATH/308-366:Q9LVL3:AB019228
LNK  Q9LWM4_ORYSA/311-371:Q9LWM4:AP001551
LNK  Q9LYQ8_ARATH/310-369:Q9LYQ8:AL163652
LNK  Q9MAM1_ARATH/315-376:Q9MAM1:AC007323
LNK  Q9SEG2_MAIZE/384-441:Q9SEG2:AF141378
LNK  Q9SEZ7_ARATH/318-377:Q9SEZ7:AY030304
LNK  Q9STV4_ARATH/303-364:Q9STV4:AL078637
LNK  Q9XFJ3_MESCR/330-391:Q9XFJ3:AF145482
LNK  Q9XIW0_ARATH/303-361:Q9XIW0:AB027153
LNK  Q9ZVD9_ARATH/308-368:Q9ZVD9:AC005623
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  O24180_ORYSA/310-369
ASQ  SVTNLNAFEIIS-FSKGFDLSGMFIVK--EWRNEARFTSNKSASTIISKLEDVAKALN-LRVRK
DSQ  TCAGTGACAAACTTAAATGCCTTTGAAATTATCTCT---TTCTCCAAGGGGTTTGATCTCTCTGGCATGTTCATTGTAAAG------GAATGGAGAAATGAGGCAAGGTTCACTTCAAATAAATCTGCCTCAACCATAATCTCAAAGCTAGAAGATGTTGCAAAGGCGCTAAAT---CTCAGGGTAAGGAAA
TRN  10010101110011000
NAM  CIPKF_ARATH/300-359
ASQ  RCINLNAFEIIS-LSTGFDLSGLFEKG--EEKEEMRFTSNREASEITEKLVEIGKDLK-MKVRK
DSQ  CGGTGTATCAACCTGAACGCGTTTGAGATCATATCT---CTGTCCACGGGGTTTGATCTCTCGGGACTGTTCGAGAAGGGA------GAGGAGAAGGAGGAGATGAGGTTTACATCAAACAGAGAGGCATCTGAGATAACAGAGAAGCTGGTGGAGATTGGGAAGGACCTTAAG---ATGAAAGTGAGGAAG
TRN  10010101100011001
NAM  Q9LVL3_ARATH/308-366
ASQ  EPTNLNAFDLIA-LSAGFDLAGLFGD---DNKRESRFTSQKPASVIISKLEEVAQRLK-LSIRK
DSQ  GAACCTACAAATTTGAACGCTTTTGATTTAATTGCC---TTGTCTGCTGGGTTTGATCTGGCAGGACTGTTTGGAGAT---------GATAACAAGAGAGAATCTAGATTCACATCACAGAAACCTGCTTCAGTGATCATATCTAAGCTGGAGGAAGTAGCACAGCGATTGAAA---CTGAGCATAAGAAAG
TRN  10010101100011000
NAM  Q9LYQ8_ARATH/310-369
ASQ  RLATLNAFDIIA-LSTGFGLAGLFGDVY--DKRESRFASQKPASEIISKLVEVAKCLK-LKIRK
DSQ  CGACTTGCTACCTTGAATGCTTTCGATATCATCGCC---TTGTCTACGGGGTTTGGTCTGGCAGGACTTTTTGGGGATGTATAT------GACAAGCGAGAATCTAGGTTCGCGTCGCAAAAACCTGCTTCAGAGATCATTTCTAAGCTAGTAGAGGTTGCCAAGTGCCTGAAG---CTGAAGATAAGAAAG
TRN  10010101100011001
NAM  O82051_SORBI/310-369
ASQ  SLPNLNAFDIIS-LSTGFDLSNLFEEKY--GRREERFTTRQPAGTVFAKLNELAERLK-LKIKK
DSQ  AGCCTCCCTAACCTGAATGCATTTGACATCATTTCT---CTTTCAACTGGATTTGACCTATCAAATTTGTTTGAAGAAAAATAT------GGCCGGAGGGAAGAGAGGTTCACCACTAGGCAGCCAGCAGGAACAGTATTTGCTAAGCTAAATGAACTGGCTGAGCGGTTAAAG---CTCAAAATTAAGAAG
TRN  10010101100011000
NAM  Q9LWM4_ORYSA/311-371
ASQ  KPVSLNAFDIIS-LSKGFDLSGLFENDK-EQKADSRFMTQKPASAIVSKLEQIAET-ESFKVKK
DSQ  AAGCCAGTGAGCTTGAATGCATTTGACATCATCTCC---CTCTCCAAAGGATTTGATCTGTCAGGCCTGTTTGAGAACGACAAA---GAGCAGAAGGCAGACTCACGGTTCATGACACAAAAACCAGCATCAGCAATAGTGTCAAAGCTAGAGCAGATTGCTGAGACA---GAGAGCTTCAAGGTGAAGAAG
TRN  10010101100011001
NAM  Q9FJ54_ARATH/298-358
ASQ  KPMSYNAFDLISSLSQGFDLSGLFEK---EERSESKFTTKKDAKEIVSKFEEIATSSERFNLTK
DSQ  AAACCGATGTCTTACAACGCGTTTGACTTGATCTCTTCGCTGTCTCAAGGATTCGATCTCTCGGGTTTGTTTGAGAAA---------GAAGAGAGATCAGAATCGAAGTTTACAACGAAGAAAGATGCAAAAGAGATAGTGTCGAAATTCGAGGAGATAGCAACAAGTAGTGAGAGATTCAATTTGACGAAG
TRN  10010101100011001
NAM  Q9SEG2_MAIZE/384-441
ASQ  RPASLNAFDIIS-FSRGFNLSGLFEE----KGDEVRFISAEPMSDIITKLEDIAKLK-SFKLRR
DSQ  CGTCCAGCAAGTCTTAATGCCTTTGATATCATATCA---TTTTCAAGGGGATTTAACTTATCAGGGTTATTTGAGGAG------------AAAGGGGATGAAGTGAGGTTCATCTCGGCTGAGCCCATGTCAGATATCATAACCAAATTGGAGGACATAGCGAAGCTGAAG---AGCTTCAAGTTGCGGAGG
TRN  10010101100011000
NAM  O65554_ARATH/311-372
ASQ  ETETLNAFHIIA-LSEGFDLSPLFEEKKKEEKREMRFATSRPASSVISSLEEAARVGNKFDVR-
DSQ  GAGACGGAGACGTTAAACGCGTTTCATATAATCGCG---TTATCGGAAGGGTTTGATTTGTCGCCGTTGTTTGAGGAGAAGAAGAAAGAGGAGAAAAGAGAGATGAGATTCGCGACGTCTCGGCCAGCGAGTAGCGTGATTTCGAGTTTGGAAGAAGCGGCGAGAGTTGGGAATAAGTTTGATGTGAGG---
TRN  10010101110011010
NAM  Q9XFJ3_MESCR/330-391
ASQ  EPEMLNAFHIIS-LSQGFDLSPLFEEKHREERQDMRFATTKSASTVVSRLEEVAAKAGKFIVK-
DSQ  GAGCCAGAGATGTTGAATGCTTTCCACATCATATCC---CTATCACAAGGGTTCGACCTGTCTCCCCTCTTCGAGGAGAAGCACAGGGAGGAGAGACAAGATATGAGATTTGCAACCACCAAGTCAGCAAGCACGGTCGTGTCGAGGCTGGAGGAAGTGGCTGCCAAGGCTGGCAAGTTCATCGTCAAA---
TRN  10010101100011001
NAM  Q9XIW0_ARATH/303-361
ASQ  SVNSITAFDLIS-LSSGLDLSGLFEAKK---KKERRFTAKVSGVEVEEKAKMIGEKLG-YVVKK
DSQ  AGTGTTAATTCGATTACTGCTTTTGATTTGATCTCG---TTATCGTCGGGATTAGATCTTTCTGGATTGTTTGAGGCTAAGAAG---------AAGAAGGAGAGGAGATTCACGGCGAAGGTTTCGGGTGTTGAAGTGGAGGAGAAGGCGAAGATGATTGGGGAGAAGTTAGGT---TATGTAGTGAAGAAG
TRN  10010101110011010
NAM  Q9C753_ARATH/327-388
ASQ  TPVTMNAFELIS-TSQGLNLGSLFEKQMGLVKRKTRFTSKSSANEIVTKIEAAAAPMG-FDVKT
DSQ  ACACCAGTAACGATGAATGCTTTTGAGCTCATCTCG---ACATCCCAGGGTCTCAATCTCGGTTCACTTTTCGAAAAACAAATGGGGCTGGTGAAACGAAAAACTCGATTTACTTCCAAATCTTCGGCTAATGAGATAGTTACAAAAATTGAGGCTGCGGCAGCACCTATGGGG---TTTGATGTCAAGACA
TRN  10010101100011001
NAM  O24342_SORBI/307-367
ASQ  EPVALNAFELIS-MSAGLNLGNLFDSEQE-FKRETRFTSKCPPKEIVRKIEEAAKPLG-FDVQK
DSQ  GAACCAGTAGCTCTGAACGCATTTGAACTGATCTCA---ATGTCAGCAGGCCTAAACCTTGGAAACTTATTCGACTCAGAGCAGGAG---TTCAAAAGAGAAACAAGGTTTACATCAAAATGTCCACCCAAAGAAATTGTCCGCAAGATTGAGGAAGCTGCAAAACCTCTAGGA---TTTGATGTTCAGAAG
TRN  10010101100011000
NAM  Q9ZVD9_ARATH/308-368
ASQ  QPAAINAFEIIS-MSRGLNLENLFDPEQE-FKRETRITLRGGANEIIEKIEEAAKPLG-FDVQK
DSQ  CAGCCAGCGGCGATCAATGCCTTCGAGATCATTTCA---ATGTCAAGGGGACTTAACCTAGAGAATCTGTTTGATCCAGAACAGGAA---TTTAAGAGGGAAACAAGGATAACATTGAGAGGAGGCGCGAATGAGATCATCGAGAAGATAGAAGAAGCTGCAAAGCCTCTCGGT---TTCGATGTTCAAAAG
TRN  10010101100011001
NAM  Q9MAM1_ARATH/315-376
ASQ  KPVSMNAFELIS-SSSEFSLENLFEKQAQLVKKETRFTSQRSASEIMSKMEETAKPLG-FNVRK
DSQ  AAACCTGTATCCATGAACGCTTTCGAACTTATCTCT---AGCTCAAGCGAGTTCAGTCTTGAAAACTTGTTCGAGAAGCAAGCGCAACTTGTGAAGAAAGAAACGCGGTTTACTTCTCAACGATCTGCGAGTGAAATAATGTCGAAAATGGAAGAAACCGCAAAGCCATTAGGC---TTTAATGTCCGTAAA
TRN  10010101110011000
NAM  Q9STV4_ARATH/303-364
ASQ  GPLTLNAFDLII-LSQGLNLATLFDRGKDSMKHQTRFISHKPANVVLSSMEVVSQSMG-FKTHI
DSQ  GGTCCACTAACTCTAAATGCGTTTGACCTAATTATT---CTATCTCAGGGCCTGAACCTCGCAACTCTTTTTGACCGTGGAAAGGACTCCATGAAGCACCAGACAAGGTTCATCTCACACAAGCCAGCAAACGTGGTTCTCTCAAGCATGGAAGTTGTGTCACAGTCTATGGGC---TTTAAGACACACATT
TRN  10010101100011001
NAM  CPK24_ARATH/306-367
ASQ  GPLMMNAFEMIT-LSQGLNLSALFDRRQDFVKRQTRFVSRREPSEIIANIEAVANSMG-FKSHT
DSQ  GGGCCCCTGATGATGAATGCCTTTGAGATGATTACC---TTATCACAAGGCTTAAATTTATCTGCACTATTTGACAGGCGACAGGATTTTGTTAAAAGGCAAACCCGTTTTGTTTCTCGAAGGGAACCTAGTGAGATAATTGCTAACATTGAGGCTGTAGCGAACTCAATGGGT---TTTAAGTCTCATACA
TRN  10010101100011000
NAM  Q9FKL0_ARATH/292-352
ASQ  SSNFINAFQIIA-MSSDLDLSGLFEENDD-KRYKTRIGSKNTAQETIKKIEAAATYVS-LSVER
DSQ  TCATCAAATTTCATAAATGCTTTTCAGATAATAGCA---ATGTCTAGTGATCTAGATTTGTCAGGTCTCTTCGAAGAAAATGATGAT---AAGAGATATAAAACAAGAATTGGGTCCAAGAACACAGCACAAGAAACAATCAAGAAGATTGAAGCTGCAGCAACTTATGTTAGT---TTATCAGTTGAGAGA
TRN  10010101110011000
NAM  Q9LGV5_ORYSA/309-369
ASQ  KPTHINAFQLIG-MASALDLSGFFEEE-DASQRKIRFTSTHSPKDLFDKIENVVTEMG-FQVQR
DSQ  AAGCCTACTCATATCAATGCTTTTCAGTTGATTGGA---ATGGCTTCTGCCCTTGATCTTTCAGGTTTCTTTGAGGAAGAG---GATGCGTCTCAAAGAAAGATAAGGTTCACATCAACACATTCACCAAAAGATTTATTCGACAAGATTGAGAATGTTGTGACGGAGATGGGA---TTCCAAGTCCAGAGG
TRN  10010101110011000
NAM  CIPK1_ARATH/314-374
ASQ  SPTIINAFQLIG-MSSFLDLSGFFEQENV-SERRIRFTSNSSAKDLLEKIETAVTEMG-FSVQK
DSQ  TCACCGACCATCATCAATGCGTTTCAGTTAATCGGA---ATGTCTTCCTTTCTTGACCTGTCCGGTTTCTTTGAACAAGAGAATGTA---TCAGAGAGGAGAATAAGATTCACTTCAAATAGCTCAGCAAAAGATTTACTGGAGAAAATCGAAACAGCCGTTACAGAAATGGGA---TTCAGTGTACAAAAG
TRN  10010101100011000
NAM  Q9LEU7_ARATH/308-367
ASQ  SPKFFNAFEFISSMSSGFDLSSLFESKR---KVQSVFTSRSSATEVMEKIETVTKEMN-MKVKR
DSQ  TCGCCGAAATTCTTCAACGCTTTCGAATTCATATCCTCGATGTCTTCCGGATTTGACTTATCGAGCTTGTTCGAGAGCAAGAGG---------AAAGTGCAATCGGTGTTTACGTCACGGTCGTCGGCGACGGAGGTAATGGAGAAGATAGAAACGGTTACGAAGGAGATGAAC---ATGAAAGTGAAGAGA
TRN  10010101110011000
NAM  Q9SEZ7_ARATH/318-377
ASQ  SPRSFNAFQFITSMSSGFDLSNLFEIKR---KPKRMFTSKFPAKSVKERLETAAREMD-MRVKH
DSQ  TCACCAAGATCCTTCAACGCCTTCCAATTCATCACATCAATGTCTTCAGGTTTCGATCTCTCTAACCTATTCGAGATAAAACGA---------AAGCCAAAGCGGATGTTCACATCGAAGTTCCCGGCGAAATCTGTTAAAGAGAGGCTGGAGACGGCGGCGCGTGAGATGGAT---ATGAGAGTGAAACAT
TRN  10010101100011001
NAM  CIPKB_ARATH/303-364
ASQ  AVKSLNAFDLIS-YSSGLDLSGLFAGCSNSSGESERFLSEKSPEMLAEEVEGFAREEN-LRMKK
DSQ  GCTGTGAAGAGTTTAAACGCGTTTGATTTGATTTCT---TACTCGTCGGGATTGGATTTGTCGGGATTGTTTGCTGGTTGTAGTAATTCGAGTGGTGAATCGGAGAGGTTTTTATCAGAAAAGTCGCCGGAGATGTTGGCGGAGGAAGTGGAGGGGTTTGCGAGAGAGGAGAAT---CTGAGGATGAAGAAG
TRN  10010101100011000
NAM  O80902_ARATH/304-364
ASQ  NGKILNAFDLIS-SASSSNLSGLFGNFVT-PDHCDQFVSDESTAVIMRKVEEVAKQLN-LRIAK
DSQ  AACGGTAAAATTCTAAACGCGTTCGATTTGATTTCT---TCGGCGTCGAGCTCGAATCTCTCCGGTTTGTTTGGAAATTTCGTGACG---CCGGATCATTGCGACCAGTTTGTATCCGATGAGAGTACGGCCGTTATTATGAGGAAGGTCGAGGAAGTTGCGAAGCAGTTAAAT---TTGAGAATCGCGAAG
TRN  10010101110011010
//