EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03812 - KdgT)
FAM  PF03812
PID  KdgT
DES  2-keto-3-deoxygluconate permease
IPR  IPR004684
ANO  3
ALN  314
AID  0.608398
APH  (KDGT_ERWCA/1-314:0.13709,KDGT_ECOLI/1-314:0.16727,KDGT_BACSU/1-314:0.57752);
ATP  (KDGT_ERWCA/1-314,KDGT_ECOLI/1-314,KDGT_BACSU/1-314);
ATL  0.88188
DNO  3
DLN  942
DID  0.59908
DPH  (KDGT_ERWCA/1-314:0.21648,KDGT_ECOLI/1-314:0.20234,KDGT_BACSU/1-314:0.49817);
DTP  (KDGT_ERWCA/1-314,KDGT_ECOLI/1-314,KDGT_BACSU/1-314);
DTL  0.91699
RID  0.608398
RPH  (KDGT_ERWCA/1-314:0.13709,KDGT_ECOLI/1-314:0.16727,KDGT_BACSU/1-314:0.57752);
RTP  (KDGT_ERWCA/1-314,KDGT_ECOLI/1-314,KDGT_BACSU/1-314);
RTL  0.88188
LNK  KDGT_BACSU/1-314:P50847:L47838
LNK  KDGT_ECOLI/1-314:P32172:AE016990
LNK  KDGT_ERWCA/1-314:Q9XB52:U17224
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  KDGT_ERWCA/1-314
ASQ  MKIKQAIDKIPGGLMLVPLFLGALCNTFTPGAGKYLGSFSNGLITGTIPILAVWFFCMGASIEFKATGTMLRKSGVLVVTKIATAWVVALIAGTFLPGDGIQNGMLAGISVLALVAAMDMTNGGLYAALMNQYGSKEEAGAFVLMSLESGPLMTMVILGASGIATFEPQLFVGAVLPFLIGFALGNLDPDLRKLFGNSVQTLIPFFAFALGNTINLSVILQTGFAGIFLGLLVIVVTGIPLILADKFIGGGNGTAGVAASSSAGAAVATPLLIANMAPEFAPVAQQATALVATSVIVTSVLVPIITALWAKRFS
DSQ  ATGAAAATCAAACAAGCTATTGATAAAATCCCTGGGGGATTAATGCTGGTGCCGCTCTTTTTGGGCGCACTCTGTAATACCTTTACGCCAGGCGCGGGGAAATACTTAGGTTCTTTCAGTAACGGCCTGATTACTGGCACAATCCCTATTCTGGCGGTATGGTTTTTCTGCATGGGCGCGTCCATTGAATTTAAAGCAACGGGAACGATGCTGAGAAAATCAGGCGTTCTGGTGGTCACCAAAATCGCCACCGCCTGGGTTGTGGCGCTGATCGCGGGCACGTTCCTGCCGGGTGACGGCATCCAAAATGGCATGCTGGCTGGGATCTCCGTGCTGGCGCTGGTCGCGGCAATGGACATGACTAACGGCGGTTTGTACGCTGCACTGATGAACCAATACGGTTCGAAAGAAGAAGCGGGTGCCTTCGTACTGATGTCTCTGGAATCCGGCCCGTTGATGACCATGGTCATTCTGGGTGCCAGCGGTATCGCTACCTTTGAACCTCAGTTATTTGTCGGTGCCGTTCTGCCTTTCCTGATTGGTTTTGCATTGGGCAACCTGGATCCGGACTTGAGAAAGCTGTTCGGTAATTCAGTACAAACGCTGATTCCTTTCTTTGCCTTTGCGTTAGGTAACACCATTAATTTATCAGTGATCCTCCAGACGGGCTTCGCCGGTATCTTCCTCGGCCTGCTCGTGATTGTTGTTACAGGTATCCCATTGATTCTGGCGGATAAATTTATCGGCGGTGGTAATGGAACCGCAGGCGTGGCCGCATCCAGCAGCGCGGGTGCCGCCGTCGCCACTCCTCTGTTGATCGCGAATATGGCTCCGGAATTCGCTCCGGTCGCTCAACAGGCAACAGCGTTAGTCGCCACCAGTGTGATCGTGACATCAGTATTGGTGCCCATCATCACGGCATTATGGGCAAAACGCTTTTCA
TRN  10010101100011000
NAM  KDGT_ECOLI/1-314
ASQ  MQIKRSIEKIPGGMMLVPLFLGALCHTFSPGAGKYFGSFTNGMITGTVPILAVWFFCMGASIKLSATGTVLRKSGTLVVTKIAVAWVVAAIASRIIPEHGVEVGFFAGLSTLALVAAMDMTNGGLYASIMQQYGTKEEAGAFVLMSLESGPLMTMIILGTAGIASFEPHVFVGAVLPFLVGFALGNLDPELREFFSKAVQTLIPFFAFALGNTIDLTVIAQTGLLGILLGVAVIIVTGIPLIIADKLIGGGDGTAGIAASSSAGAAVATPVLIAEMVPAFKPMAPAATSLVATAVIVTSILVPILTSIWSRKVK
DSQ  ATGCAGATAAAACGCTCGATTGAGAAAATCCCGGGGGGGATGATGCTCGTCCCGCTATTCCTTGGCGCACTGTGCCACACCTTCTCGCCGGGGGCGGGGAAATATTTTGGATCATTCACCAACGGGATGATTACCGGTACGGTGCCCATTCTGGCGGTGTGGTTTTTTTGCATGGGGGCGTCAATAAAATTAAGCGCGACGGGAACGGTACTGCGTAAATCCGGTACGCTGGTGGTAACTAAAATTGCCGTCGCGTGGGTGGTTGCGGCAATTGCCTCGCGCATTATTCCGGAACATGGTGTTGAAGTTGGATTCTTTGCCGGACTTTCAACGCTGGCGCTGGTGGCGGCGATGGATATGACCAACGGCGGACTTTACGCTTCCATCATGCAGCAGTACGGTACGAAAGAAGAAGCTGGGGCATTTGTGTTGATGTCGTTGGAGTCCGGGCCGCTCATGACGATGATTATTCTGGGCACTGCCGGGATTGCCTCGTTTGAACCGCATGTTTTCGTCGGCGCAGTATTACCGTTCCTGGTGGGCTTTGCCCTGGGGAATCTTGACCCTGAATTACGAGAATTTTTCAGCAAAGCGGTGCAAACGCTGATTCCATTCTTTGCCTTCGCGCTGGGCAATACCATTGATTTGACTGTGATTGCCCAGACTGGTTTGCTGGGGATCCTGTTGGGTGTGGCAGTAATTATCGTGACCGGTATTCCGTTGATTATCGCCGATAAATTGATTGGCGGTGGCGATGGCACTGCCGGAATTGCCGCTTCCAGTTCCGCAGGGGCCGCGGTAGCGACACCTGTGCTGATTGCAGAAATGGTGCCTGCGTTTAAACCGATGGCTCCGGCAGCAACTTCGCTGGTAGCGACGGCGGTCATTGTGACTTCGATTCTGGTGCCAATTCTTACCTCTATCTGGTCACGTAAAGTCAAA
TRN  10010101100011000
NAM  KDGT_BACSU/1-314
ASQ  MKIKATIERVPGGMMIIPLFLGAALNTFAPGTAEFFGGFTGALITGTLPILGVFIFCVGATIDFRSSGYIARKGITLLLGKIGFAALLGVIAAQFIPDDGIQSGFFAGLSVLAIVAVMNETNGGLYLALMNHMGRKEDAGAFAFISTESGPFMTMVTFGVTGLAAFPWETLAATVIPFLLGCILGNLDHDLRDLFSKVVPAIIPFFAFSLGNTLNFGMLIQSGLLGIFIGVSVVILSGSSLFLLDRFIARGDGVAGVAASSTAGAAVAVPYALAEANASFAPVAESATAIIATSVIVTSLLTPLATVWVDKKIK
DSQ  ATGAAAATCAAGGCGACAATTGAACGGGTACCTGGCGGAATGATGATTATTCCGCTATTTCTTGGAGCGGCGCTCAACACGTTTGCGCCTGGAACAGCGGAGTTCTTTGGAGGGTTTACGGGTGCTTTGATTACCGGAACGCTGCCGATACTGGGTGTTTTTATCTTTTGCGTAGGAGCAACGATTGATTTTCGTTCTTCAGGCTATATCGCAAGAAAAGGAATCACGTTATTATTGGGGAAGATCGGATTTGCGGCGCTGCTCGGCGTGATCGCAGCGCAATTTATACCTGACGATGGCATACAATCCGGCTTTTTTGCAGGCCTTTCTGTTTTAGCAATTGTCGCGGTAATGAATGAAACGAACGGCGGACTGTATTTGGCGCTCATGAATCACATGGGAAGAAAAGAGGATGCGGGCGCTTTCGCCTTTATCAGTACAGAATCTGGTCCTTTTATGACCATGGTGACGTTTGGTGTGACGGGACTTGCCGCATTCCCATGGGAAACGCTGGCAGCGACAGTCATCCCGTTTTTACTTGGATGTATACTTGGAAATCTGGATCATGATCTCAGAGACTTATTCAGCAAGGTTGTGCCGGCGATCATTCCATTTTTCGCCTTTTCGCTCGGCAATACCTTGAATTTTGGAATGCTGATCCAATCAGGGCTGCTCGGCATTTTTATCGGAGTTTCTGTCGTCATTTTATCGGGCAGTTCTTTGTTTTTGCTTGATCGTTTTATTGCGCGGGGAGATGGTGTCGCGGGAGTGGCCGCTTCTTCTACGGCAGGGGCGGCTGTAGCCGTGCCATATGCATTAGCGGAAGCGAATGCCTCATTTGCGCCAGTTGCTGAGTCGGCAACTGCAATTATCGCGACAAGCGTTATTGTCACCTCGCTCTTAACCCCGCTGGCAACAGTGTGGGTAGATAAAAAAATCAAG
TRN  10010101100011000
//