EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03811 - Ins_element1)
FAM  PF03811
PID  Ins_element1
DES  Insertion element protein
IPR  IPR003220
ANO  4
ALN  88
AID  0.52095
APH  ((Q9AM88_9ENTR/1-88:0.37165,INSA_ECOLI/1-88:0.56501):0.20071,INA2_SHIDY/1-87:0.14433,Q9AFV1_SHIFL/5-91:0.22686);
ATP  ((Q9AM88_9ENTR/1-88,INSA_ECOLI/1-88),INA2_SHIDY/1-87,Q9AFV1_SHIFL/5-91);
ATL  1.50856
DNO  4
DLN  264
DID  0.578196
DPH  (Q9AFV1_SHIFL/5-91:0.19965,INA2_SHIDY/1-87:0.17100,(INSA_ECOLI/1-88:0.53725,Q9AM88_9ENTR/1-88:0.28528):0.13396);
DTP  (Q9AFV1_SHIFL/5-91,INA2_SHIDY/1-87,(INSA_ECOLI/1-88,Q9AM88_9ENTR/1-88));
DTL  1.32714
RID  0.52095
RPH  ((Q9AM88_9ENTR/1-88:0.37165,INSA_ECOLI/1-88:0.56501):0.20071,INA2_SHIDY/1-87:0.14433,Q9AFV1_SHIFL/5-91:0.22686);
RTP  ((Q9AM88_9ENTR/1-88,INSA_ECOLI/1-88),INA2_SHIDY/1-87,Q9AFV1_SHIFL/5-91);
RTL  1.50856
LNK  INA2_SHIDY/1-87:P03829:J01737
LNK  INSA_ECOLI/1-88:P03827:J01729
LNK  Q9AFV1_SHIFL/5-91:Q9AFV1:AF348706
LNK  Q9AM88_9ENTR/1-88:Q9AM88:AF327446
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9AFV1_SHIFL/5-91
ASQ  MTTVTVHCPRCNSDE-VYRHGRSCSRHERFRCRSCKRVFQLTYSYEARKLGVKEQIVEMAHNGAGGCYTARTLKIGINTVIRTLKSSR
DSQ  ATGACTACCGTTACTGTTCATTGTCCGCGCTGTAATTCCGATGAA---GTTTATCGACATGGCCGTAGTTGTTCCCGGCATGAGCGTTTCCGTTGTCGCTCATGTAAACGTGTTTTCCAGCTCACTTACTCTTATGAAGCCAGAAAACTCGGCGTTAAGGAGCAGATCGTTGAAATGGCACATAACGGCGCAGGGGGCTGTTATACCGCCAGAACACTGAAAATCGGCATCAATACCGTCATACGGACATTAAAAAGCTCTCGC
TRN  10010101100011000
NAM  INA2_SHIDY/1-87
ASQ  MASVNIHCPRCQSAQ-VYRHGQNPKGHDRFRCRDCHRVFQLTYTYEARKPGIKELITEMAFNGAGVRDTARTLKIGINTVIRTLKNSR
DSQ  ATGGCCAGCGTTAACATTCATTGTCCTCGTTGTCAGTCTGCACAG---GTCTACCGCCATGGTCAGAACCCTAAAGGCCATGACAGATTTCGCTGCCGTGACTGCCACCGCGTTTTTCAGCTCACTTACACTTATGAGGCCCGTAAGCCGGGCATTAAAGAGCTGATCACTGAAATGGCCTTCAATGGCGCCGGGGTTCGCGATACCGCCAGGACACTGAAAATTGGCATTAACACCGTCATCCGGACTTTAAAAAACTCACGC
TRN  10010101100011000
NAM  Q9AM88_9ENTR/1-88
ASQ  MAKVDVKCPFCEQTESVKKHGQGKTGHQRYRCQLCRRTFQLDYAYRACQPGMKEQIVDLAMNNACIRYTARALHISINAVVRTLKNSR
DSQ  ATGGCTAAAGTTGACGTAAAATGCCCTTTTTGTGAGCAGACCGAATCCGTTAAAAAACATGGGCAGGGTAAAACCGGCCATCAGCGCTATCGCTGCCAGTTATGCCGCCGTACTTTCCAGCTCGACTATGCCTATCGTGCCTGTCAGCCCGGAATGAAAGAACAGATTGTCGATCTTGCAATGAACAATGCGTGCATTCGTTACACCGCCCGAGCGCTACATATCAGTATCAATGCCGTTGTTCGCACCTTAAAAAACTCTCGC
TRN  11011101111011010
NAM  INSA_ECOLI/1-88
ASQ  MASVSISCPSCSATDGVVRNGKSTAGHQRYLCSHCRKTWQLQFTYTASQPGTHQKIIDMAMNGVGCRATARIMGVGLNTILRHLKNSG
DSQ  GTGGCTTCTGTTTCTATCAGCTGTCCCTCCTGTTCAGCTACTGACGGGGTGGTGCGTAACGGCAAAAGCACCGCCGGACATCAGCGCTATCTCTGCTCTCACTGCCGTAAAACATGGCAACTGCAGTTCACTTACACCGCTTCTCAACCCGGTACGCACCAGAAAATCATTGATATGGCCATGAATGGCGTTGGATGCCGGGCAACAGCCCGCATTATGGGCGTTGGCCTCAACACGATTTTACGTCACTTAAAAAACTCAGGC
TRN  11011101101011000
//