EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03760 - LEA_1)
FAM  PF03760
PID  LEA_1
DES  Late embryogenesis abundant (LEA) group 1
IPR  IPR005513
ANO  8
ALN  73
AID  0.434631
APH  (((Q8H683_ORYSA/1-73:0.61115,(Q9ZTZ2_SOYBN/1-73:0.03362,Q9XES9_SOYBN/1-73:0.06928):0.15871):0.09192,(Q40928_PSEMZ/8-80:0.45267,(PM1_SOYBN/8-80:0.18972,Q96272_ARATH/1-73:0.22712):0.61325):0.28277):0.10100,Q96273_ARATH/1-70:0.34700,Q42167_ARATH/1-73:0.20639);
ATP  (((Q8H683_ORYSA/1-73,(Q9ZTZ2_SOYBN/1-73,Q9XES9_SOYBN/1-73)),(Q40928_PSEMZ/8-80,(PM1_SOYBN/8-80,Q96272_ARATH/1-73))),Q96273_ARATH/1-70,Q42167_ARATH/1-73);
ATL  3.3846
DNO  8
DLN  219
DID  0.535591
DPH  (((((Q9XES9_SOYBN/1-73:0.05158,Q9ZTZ2_SOYBN/1-73:0.02626):0.17396,(Q96273_ARATH/1-70:0.25759,Q8H683_ORYSA/1-73:0.40106):0.08425):0.04786,Q42167_ARATH/1-73:0.21049):0.22695,Q40928_PSEMZ/8-80:0.43515):0.44464,PM1_SOYBN/8-80:0.14446,Q96272_ARATH/1-73:0.29948);
DTP  (((((Q9XES9_SOYBN/1-73,Q9ZTZ2_SOYBN/1-73),(Q96273_ARATH/1-70,Q8H683_ORYSA/1-73)),Q42167_ARATH/1-73),Q40928_PSEMZ/8-80),PM1_SOYBN/8-80,Q96272_ARATH/1-73);
DTL  2.80372
RID  0.434631
RPH  (((Q8H683_ORYSA/1-73:0.61115,(Q9ZTZ2_SOYBN/1-73:0.03362,Q9XES9_SOYBN/1-73:0.06928):0.15871):0.09192,(Q40928_PSEMZ/8-80:0.45267,(PM1_SOYBN/8-80:0.18972,Q96272_ARATH/1-73:0.22712):0.61325):0.28277):0.10100,Q96273_ARATH/1-70:0.34700,Q42167_ARATH/1-73:0.20639);
RTP  (((Q8H683_ORYSA/1-73,(Q9ZTZ2_SOYBN/1-73,Q9XES9_SOYBN/1-73)),(Q40928_PSEMZ/8-80,(PM1_SOYBN/8-80,Q96272_ARATH/1-73))),Q96273_ARATH/1-70,Q42167_ARATH/1-73);
RTL  3.3846
LNK  PM1_SOYBN/8-80:Q01417:M80666
LNK  Q40928_PSEMZ/8-80:Q40928:Z49711
LNK  Q42167_ARATH/1-73:Q42167:Z27059
LNK  Q8H683_ORYSA/1-73:Q8H683:AP002805
LNK  Q96272_ARATH/1-73:Q96272:X91915
LNK  Q96273_ARATH/1-70:Q96273:X91917
LNK  Q9XES9_SOYBN/1-73:Q9XES9:AF117725
LNK  Q9ZTZ2_SOYBN/1-73:Q9ZTZ2:AF004810
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q96272_ARATH/1-73
ASQ  MQSMKETASNIAASAKSGMDKTKATLEEKAEKMKTRDPVQKQMATQVKEDKINQAEMHKRETRQHNAAMKEAA
DSQ  ATGCAGTCGATGAAAGAAACAGCTTCGAATATTGCAGCTTCTGCAAAATCTGGCATGGACAAAACCAAAGCTACCTTGGAGGAAAAGGCGGAGAAGATGAAGACACGAGACCCTGTTCAGAAACAGATGGCTACACAGGTTAAAGAAGATAAGATCAATCAAGCTGAGATGCATAAGAGAGAAACGCGTCAGCACAACGCGGCCATGAAAGAAGCGGCT
TRN  10110101110011011
NAM  PM1_SOYBN/8-80
ASQ  GESIKETATNIGASAKAGMEKTKATVQEKAERMTARDPVQKELATQKKEAKMNQAELDKQAARQHNTAAKQSA
DSQ  GGAGAGTCCATTAAGGAAACAGCTACAAACATTGGTGCTTCTGCCAAGGCTGGCATGGAGAAGACCAAGGCCACTGTCCAAGAGAAGGCAGAAAGAATGACAGCACGTGATCCGGTGCAAAAGGAGTTGGCAACCCAAAAGAAAGAGGCAAAGATGAACCAGGCGGAGCTGGACAAGCAGGCGGCGCGTCAGCATAACACGGCGGCCAAACAGTCCGCC
TRN  10010101100011011
NAM  Q40928_PSEMZ/8-80
ASQ  AAAAKEKMSNAAATTKEKLDKTKASAEEKMHKSTAHSKGEREIAHQEKEAKEAEAEMRKHSAKAENKIQREEE
DSQ  GCCGCTGCAGCCAAGGAGAAGATGAGTAACGCGGCAGCCACTACTAAGGAGAAATTGGACAAAACCAAGGCATCTGCCGAGGAGAAGATGCATAAAAGTACTGCCCACAGCAAGGGAGAAAGGGAGATAGCGCATCAGGAGAAGGAAGCCAAAGAAGCAGAGGCAGAAATGAGAAAACATTCTGCTAAAGCTGAGAACAAAATCCAACGAGAGGAGGAG
TRN  10010101110011011
NAM  Q8H683_ORYSA/1-73
ASQ  MQAVKEKVKDKVSAVKAKGKVSKAKADEKKEVATARSHAERELAHERAKARVAAAKMELHQDKALHREEAIQH
DSQ  ATGCAGGCGGTGAAGGAGAAGGTGAAGGACAAGGTGAGCGCGGTGAAGGCGAAGGGGAAGGTGAGCAAGGCCAAGGCCGACGAGAAGAAGGAGGTGGCGACGGCGAGGTCCCACGCCGAGAGGGAGCTGGCGCACGAGCGCGCTAAGGCCAGGGTCGCCGCCGCCAAGATGGAGCTGCACCAGGACAAGGCCCTCCACCGCGAGGAGGCCATCCAGCAC
TRN  10010101100011011
NAM  Q96273_ARATH/1-70
ASQ  MQSAKEKISDMASTAKEKLNIGGAKAQGHAEKTMARTKKEKKLAQEREKSKEAQAKADLHQSKAEHAADA---
DSQ  ATGCAGTCGGCGAAGGAAAAGATCAGTGACATGGCCAGTACGGCCAAGGAGAAACTCAACATCGGTGGCGCAAAGGCACAAGGTCATGCGGAGAAGACGATGGCAAGGACCAAAAAAGAGAAGAAGTTGGCCCAAGAGCGAGAGAAGTCTAAGGAGGCGCAGGCCAAAGCTGACCTCCATCAATCCAAGGCTGAGCATGCTGCGGACGCT---------
TRN  10010101110011011
NAM  Q42167_ARATH/1-73
ASQ  MQSAKQKISDMASTAKEKMVICQAKADEKAERAMARTKEEKEIAHQRRKAKEADANMDMHMAKAAHAEDKLMA
DSQ  ATGCAATCGGCGAAACAGAAGATAAGCGATATGGCTAGTACAGCCAAGGAGAAGATGGTGATATGTCAAGCAAAAGCTGATGAGAAGGCAGAGCGGGCGATGGCGAGGACGAAAGAGGAGAAAGAGATAGCGCACCAACGGAGAAAGGCGAAGGAAGCAGACGCGAATATGGATATGCACATGGCTAAAGCGGCTCATGCGGAAGACAAGCTTATGGCT
TRN  10010101110011011
NAM  Q9ZTZ2_SOYBN/1-73
ASQ  MQSSKEKMKNMASAAKEQVDIYKAKIDEKAEKATARTEEERVIAHEHAKAKEAGAKMELHEAKARHAAEKLSA
DSQ  ATGCAATCCTCAAAGGAGAAGATGAAAAACATGGCAAGTGCTGCCAAGGAACAAGTCGACATCTATAAAGCCAAAATAGACGAGAAGGCAGAGAAAGCAACGGCAAGAACAGAAGAGGAGAGGGTGATAGCCCATGAGCACGCAAAGGCAAAGGAAGCTGGAGCAAAGATGGAGCTGCATGAAGCTAAAGCAAGGCATGCAGCAGAGAAGCTAAGCGCC
TRN  10010101100011001
NAM  Q9XES9_SOYBN/1-73
ASQ  MQSSKEKLKNMTSAAKEQVDIYKAKIDEKTEKATARTEEERVITHERAKAKEAEAKMELHEAKARHAAEKLST
DSQ  ATGCAATCTTCAAAGGAGAAGCTGAAAAACATGACCAGTGCTGCCAAGGAGCAAGTCGACATCTATAAAGCAAAAATAGACGAGAAGACAGAGAAAGCAACGGCAAGAACAGAAGAGGAGAGGGTGATTACCCATGAACGTGCAAAGGCAAAGGAAGCTGAAGCAAAGATGGAGCTGCATGAAGCAAAAGCCAGGCATGCAGCAGAGAAGCTAAGCACC
TRN  10010101100011001
//