EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03746 - LamB_YcsF)
FAM  PF03746
PID  LamB_YcsF
DES  LamB/YcsF family
IPR  IPR005501
ANO  16
ALN  256
AID  0.433691
APH  ((((((((Y1821_BACHD/3-244:0.31847,Y1605_STAAM/2-243:0.35130):0.10959,(Y986_PYRHO/2-243:0.34243,Y1541_CAMJE/3-244:0.26657):0.16016):0.07430,((Y1729_HAEIN/3-239:0.22388,Y030_NEIMA/3-239:0.32819):0.17713,YBGL_ECOLI/2-238:0.35883):0.17122):0.05918,Y150_BORPE/4-245:0.33387):0.04509,LAMB_EMENI/7-254:1.19968):0.13159,((Y333_MYCLE/3-244:0.33473,Y441_STRCO/1-242:0.29336):0.30403,(Y2984_DEIRA/6-249:0.57075,Y492_PSEAE/3-244:0.51634):0.10965):0.08937):0.22960,Y3576_VIBCH/5-246:0.34598):0.12623,Y4511_PSEAE/7-251:0.31395,Y2112_PSEAE/3-247:0.28818);
ATP  ((((((((Y1821_BACHD/3-244,Y1605_STAAM/2-243),(Y986_PYRHO/2-243,Y1541_CAMJE/3-244)),((Y1729_HAEIN/3-239,Y030_NEIMA/3-239),YBGL_ECOLI/2-238)),Y150_BORPE/4-245),LAMB_EMENI/7-254),((Y333_MYCLE/3-244,Y441_STRCO/1-242),(Y2984_DEIRA/6-249,Y492_PSEAE/3-244))),Y3576_VIBCH/5-246),Y4511_PSEAE/7-251,Y2112_PSEAE/3-247);
ATL  8.17874
DNO  14
DLN  768
DID  0.497494
DPH  ((((((YBGL_ECOLI/2-238:0.28534,(LAMB_EMENI/7-254:0.76773,(((Y986_PYRHO/2-243:0.35799,Y1541_CAMJE/3-244:0.22829):0.10266,Y1605_STAAM/2-243:0.31507):0.10592,Y1821_BACHD/3-244:0.24638):0.16553):0.08985):0.07681,Y030_NEIMA/3-239:0.35750):0.13525,Y150_BORPE/4-245:0.21972):0.10134,((Y333_MYCLE/3-244:0.32932,Y441_STRCO/1-242:0.23662):0.14857,Y492_PSEAE/3-244:0.31659):0.07996):0.08472,Y3576_VIBCH/5-246:0.41142):0.06739,Y4511_PSEAE/7-251:0.21168,Y2112_PSEAE/3-247:0.21392);
DTP  ((((((YBGL_ECOLI/2-238,(LAMB_EMENI/7-254,(((Y986_PYRHO/2-243,Y1541_CAMJE/3-244),Y1605_STAAM/2-243),Y1821_BACHD/3-244))),Y030_NEIMA/3-239),Y150_BORPE/4-245),((Y333_MYCLE/3-244,Y441_STRCO/1-242),Y492_PSEAE/3-244)),Y3576_VIBCH/5-246),Y4511_PSEAE/7-251,Y2112_PSEAE/3-247);
DTL  5.58326
RID  0.43484
RPH  ((((((Y150_BORPE/4-245:0.37027,(Y986_PYRHO/2-243:0.32540,Y1541_CAMJE/3-244:0.28264):0.15701):0.05085,((Y1821_BACHD/3-244:0.31126,Y1605_STAAM/2-243:0.35059):0.09144,(Y030_NEIMA/3-239:0.41922,YBGL_ECOLI/2-238:0.38249):0.17625):0.05538):0.03635,LAMB_EMENI/7-254:1.17890):0.14550,((Y333_MYCLE/3-244:0.34730,Y441_STRCO/1-242:0.28467):0.29506,Y492_PSEAE/3-244:0.54544):0.11638):0.22104,Y3576_VIBCH/5-246:0.34423):0.13746,Y4511_PSEAE/7-251:0.32228,Y2112_PSEAE/3-247:0.27899);
RTP  ((((((Y150_BORPE/4-245,(Y986_PYRHO/2-243,Y1541_CAMJE/3-244)),((Y1821_BACHD/3-244,Y1605_STAAM/2-243),(Y030_NEIMA/3-239,YBGL_ECOLI/2-238))),LAMB_EMENI/7-254),((Y333_MYCLE/3-244,Y441_STRCO/1-242),Y492_PSEAE/3-244)),Y3576_VIBCH/5-246),Y4511_PSEAE/7-251,Y2112_PSEAE/3-247);
RTL  7.22885
LNK  LAMB_EMENI/7-254:P38096:M77283
LNK  Y030_NEIMA/3-239:Q9JQN2:AJ391262
LNK  Y150_BORPE/4-245:O30444:AF006000
LNK  Y1541_CAMJE/3-244:Q9PMC8:AL139078
LNK  Y1605_STAAM/2-243:P67622:AP003362
LNK  Y1729_HAEIN/3-239:P45347:
LNK  Y1821_BACHD/3-244:Q9KBV3:AP001513
LNK  Y2112_PSEAE/3-247:Q9I203:AE004638
LNK  Y2984_DEIRA/6-249:Q9RYM7:
LNK  Y333_MYCLE/3-244:Q9CCW2:AL583918
LNK  Y3576_VIBCH/5-246:Q9KLG8:AE004405
LNK  Y441_STRCO/1-242:Q9RL45:AL939105
LNK  Y4511_PSEAE/7-251:Q9HVR0:AE004864
LNK  Y492_PSEAE/3-244:Q9I626:AE004486
LNK  Y986_PYRHO/2-243:O58714:AP000004
LNK  YBGL_ECOLI/2-238:P75746:U00096
AMK  xxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Y492_PSEAE/3-244
ASQ  EVDLNSDMGEGFGPWTIGDgVDAAIMPLISSANIATGFHAGDPSSMRRTVEMAAEHGVAIGAHPGFRDLVGFGRRHIAAPAIELVNDMLYQLGALREFARLQGLSLQHVKPHGALYMHLARDEVAARLFVETLQRLEPELLLYCMP---GSATWR-----.--IGRELGQPLVREFYADRDYDRSGSIVFTRRVAAL--DPQQVADKVL-RACREGKVRTVEGEDLDIAFDSVCIHSDTPGALELVASTRARLEGA
DSQ  GAAGTCGACCTCAATTCCGACATGGGCGAAGGCTTCGGCCCATGGACCATCGGCGATggcGTGGACGCGGCGATCATGCCGCTGATCAGCAGCGCCAACATCGCCACCGGTTTCCATGCCGGCGACCCGAGCAGCATGCGCCGCACCGTGGAGATGGCCGCCGAGCATGGCGTGGCCATCGGCGCCCATCCGGGCTTCCGCGACCTGGTCGGCTTCGGGCGTCGGCACATCGCCGCGCCGGCCATCGAGCTGGTCAACGACATGCTCTACCAGCTTGGCGCACTGCGCGAATTCGCCCGGCTGCAGGGCCTGTCGCTGCAACACGTCAAGCCCCACGGCGCGCTCTACATGCACCTGGCGCGGGACGAGGTCGCCGCGCGCCTGTTCGTCGAGACCCTGCAACGCCTGGAACCGGAACTGCTGCTCTATTGCATGCCC---------GGTTCGGCCACCTGGCGC---------------...------ATCGGCCGGGAACTGGGCCAGCCGCTGGTGCGCGAGTTCTACGCCGACCGCGACTACGACCGCAGCGGCTCCATCGTCTTCACCCGGCGGGTCGCCGCCCTC------GATCCGCAGCAGGTCGCCGACAAGGTCCTG---CGCGCCTGCCGCGAGGGCAAGGTGCGCACCGTCGAGGGCGAGGACCTCGACATCGCCTTCGACTCGGTGTGCATCCACAGCGATACCCCCGGTGCCCTGGAGCTGGTCGCCAGCACCCGTGCGCGCCTGGAGGGCGCC
TRN  11011111101111111
NAM  Y3576_VIBCH/5-246
ASQ  TIQLNCDMGESFGVWTMGA.-DEEVMPWIDMANIACGFHASDPHVMSRTIDLALEHEVMIGAHPSYPDLQGFGRRSLAMNEQEVSEIILYQVGALKALCESKNGQLSYVKPHGALYNDMMSDPSIFRAVVDAVSCFNL--PLMVLASANNQDYLD-----.--IADRFDVPLLFEAFADRTYLANGKLTPRSQPNAVLSSEEAILNQVR-QIARYGKVTSSDGFVIPIEADTLCVHGDNPNAVSLIARIRAALDE-
DSQ  ACAATCCAACTCAATTGCGATATGGGCGAAAGCTTCGGCGTCTGGACCATGGGGGCC...---GATGAAGAAGTGATGCCTTGGATTGATATGGCCAATATCGCTTGTGGCTTTCACGCGTCCGATCCTCATGTTATGAGCCGTACGATAGATTTAGCGCTTGAGCATGAAGTGATGATAGGTGCCCATCCTAGCTACCCAGATTTGCAAGGATTTGGTCGCCGCTCGTTGGCGATGAATGAGCAAGAAGTGAGTGAAATCATTCTTTACCAAGTCGGCGCACTGAAGGCGCTGTGTGAAAGTAAAAATGGCCAATTGAGCTATGTGAAACCTCATGGCGCGCTGTATAACGACATGATGAGCGACCCGAGCATCTTTCGTGCGGTGGTCGATGCCGTTTCCTGTTTTAACCTG------CCTTTGATGGTGCTCGCTTCTGCCAACAATCAAGACTATCTCGAT---------------...------ATTGCGGACCGTTTTGATGTACCACTGCTGTTTGAAGCTTTTGCCGACCGTACCTATCTCGCCAATGGCAAGCTGACACCGCGCTCACAACCCAATGCGGTACTCAGTAGCGAAGAAGCCATTCTCAACCAAGTGCGA---CAAATCGCCCGTTACGGCAAAGTCACCAGTTCTGATGGGTTCGTCATCCCGATTGAAGCGGATACTTTATGTGTGCACGGCGATAACCCAAACGCCGTGTCGCTCATTGCCAGAATTCGTGCTGCGTTGGATGAG---
TRN  10010101100011000
NAM  Y2112_PSEAE/3-247
ASQ  NLLLNCDIGESFGAWRMGL.-DAEVMPLIDCANIACGFHAGDPGTMRRTVALAVEHGVRIGAHPGYPDLVGFGRRSLACSAQEVEDLLLYQIGALDGLCRAQGTRVRYVKPHGALYQDMMRDPAILAAVLRALAAYDRTLPLMLMSTRDNTAARA-----.--LGEAHGIELWFEAFADRAYDGAGYLVSRSQPGAVHHDAETVLAQAL-LLARGAALRASDGSALALEAQTLCVHGDNPASLAAVRRIRDALEAA
DSQ  AACCTGTTGTTGAACTGCGATATCGGCGAGAGCTTCGGTGCCTGGCGCATGGGCCTG...---GACGCCGAGGTGATGCCGCTGATCGATTGCGCCAACATCGCCTGCGGCTTCCACGCCGGCGATCCCGGCACCATGCGCCGCACCGTGGCCCTGGCGGTGGAGCATGGCGTGCGCATCGGCGCGCACCCCGGCTACCCCGACCTGGTCGGCTTCGGCCGGCGCTCGCTGGCCTGCTCGGCGCAGGAAGTGGAAGACCTGCTGCTCTACCAGATCGGCGCCCTCGACGGACTCTGCCGCGCCCAGGGCACGCGGGTACGCTACGTCAAGCCGCATGGCGCCCTGTACCAGGACATGATGCGCGACCCGGCGATCCTCGCCGCCGTGCTGCGCGCACTGGCGGCCTACGACCGCACCCTGCCGCTGATGCTGATGAGCACCCGCGACAACACCGCGGCGCGCGCG---------------...------CTGGGCGAGGCCCACGGCATCGAGCTGTGGTTCGAGGCGTTCGCCGACCGCGCCTACGACGGCGCCGGCTACCTGGTCTCGCGCAGCCAGCCCGGCGCGGTACACCACGACGCCGAGACGGTGCTCGCCCAGGCCCTC---CTGCTGGCCCGTGGCGCGGCGCTGCGAGCCAGCGACGGCAGCGCCCTGGCGCTGGAGGCGCAGACCCTCTGCGTACACGGCGACAACCCCGCCTCGCTGGCTGCGGTGCGGCGCATCCGCGACGCCCTGGAGGCGGCA
TRN  11011111101111111
NAM  Y4511_PSEAE/7-251
ASQ  RILLNCDMGESFGAWRMGD.-DVHSMPLVDQANLACGFHAGDPLTMRRAVELAVRHGVSIGAHPAYPDLSGFGRRSLACSAEEVHAMVLYQIGALDAFCRSLGTQVAYVKPHGALYNDLVGDDELLRAVLDACAAYRKGLPLMVLALADNGRELE-----.--LADEADVPLLFEAFADRAYLPDGRLAPRRLGGAVHHDPQRIIEQAL-AIARGEAFPDYDGNPLRLTADSLCVHGDNPQSLAVLRRLRAALDSL
DSQ  CGTATCCTGCTCAACTGCGACATGGGCGAAAGCTTTGGCGCCTGGCGCATGGGCGAC...---GATGTCCACAGCATGCCGCTGGTTGACCAGGCCAACCTGGCTTGCGGCTTCCACGCTGGCGATCCGCTCACCATGCGGCGCGCGGTGGAGCTGGCGGTACGCCATGGCGTGAGCATCGGCGCGCACCCTGCCTATCCCGACCTGAGCGGCTTCGGCCGGCGCTCGCTGGCCTGCTCTGCCGAAGAGGTGCATGCCATGGTGCTGTACCAGATCGGCGCGCTGGACGCTTTCTGCCGTTCCCTCGGTACCCAGGTGGCCTACGTCAAGCCGCATGGCGCGCTGTACAACGACCTGGTCGGCGACGATGAGCTGCTGCGCGCCGTGCTCGACGCCTGCGCCGCCTATCGCAAGGGCCTGCCGCTGATGGTGCTGGCCCTGGCCGACAACGGCCGCGAGCTGGAA---------------...------CTGGCCGACGAGGCCGACGTGCCGCTGCTGTTCGAGGCCTTCGCCGATCGCGCCTACCTGCCGGACGGTCGGCTGGCGCCGCGGCGGCTTGGCGGCGCGGTGCATCACGATCCGCAGCGGATCATCGAACAGGCCCTG---GCCATCGCCCGCGGCGAAGCCTTCCCCGACTACGACGGCAACCCGCTGCGCCTGACCGCCGACAGTCTTTGCGTGCATGGCGATAACCCGCAGTCGCTCGCGGTCCTCCGGCGCCTGCGCGCGGCCCTGGACAGCCTG
TRN  11011111101111111
NAM  Y2984_DEIRA/6-249
ASQ  TTDLNADAGESFGHWPLGD.-DARLFPLLTSVNLALGFHAGDPVTLHSAVRLARQHGLGIGAHPGYPDLVGFGRRELALTPLEIQAATLYQIGALQAFLTVEGGTLQHVKAHGALYMRIHEDRAAGEAFCHAVQQLVPQAYLIVLAGAAGSDLAL-----.--TAAAHGLRVRREAFPERAYTGDGRLASRQLPGSSIHDPAEAARRAV-GMAQ-GWVQTLGGERLALEMDTLCIHGDNPQAVAIAGAIRAALAEN
NAM  Y441_STRCO/1-242
ASQ  MIDLNADLGEGFGRWTLTD.-DDALLSVVTSANVACGFHAGDPSVMRRVCDLAAERGVRIGAQVSYRDLAGFGRRAMDVPSDELAAEVAYQIGALRVFAEAAGAPVAYVKPHGALYNRTVHDEGQARAVVAGVRLAGGALPVLGLP---GSRLLT-----.--AAAEAGLTGVPEAFADRAYTAEGSLVPRSEAGSVVTDEDAVVRRAL-AFAVEGSVEAVDGTAVAVAARSLCVHGDTPNAARIAARVREALETA
DSQ  GTGATCGACCTCAACGCAGATCTCGGTGAAGGCTTCGGCCGCTGGACCCTCACTGAC...---GACGACGCCCTGCTCTCCGTCGTCACCAGCGCCAACGTCGCGTGCGGCTTCCACGCGGGCGACCCCTCGGTGATGCGCCGCGTCTGCGATCTCGCCGCGGAGCGCGGGGTGCGGATCGGGGCGCAGGTGTCCTACCGCGACCTGGCGGGCTTCGGCCGGCGCGCCATGGACGTGCCCTCCGACGAGCTGGCGGCCGAGGTGGCGTACCAGATCGGCGCCCTCCGGGTGTTCGCCGAGGCCGCCGGCGCCCCGGTCGCCTACGTGAAGCCGCACGGCGCGCTCTACAACCGCACCGTCCACGACGAGGGTCAGGCACGTGCCGTCGTGGCCGGGGTGCGGCTGGCCGGCGGCGCGCTGCCCGTGCTCGGCCTCCCC---------GGCTCGCGGCTGCTCACG---------------...------GCCGCCGCGGAGGCGGGCCTCACCGGCGTCCCGGAGGCCTTCGCGGACCGTGCGTACACCGCGGAGGGCAGCTTGGTCCCCCGTAGCGAGGCGGGCTCGGTGGTGACGGACGAGGACGCGGTGGTGCGCCGCGCGCTG---GCGTTCGCCGTGGAGGGCTCCGTCGAGGCCGTGGACGGTACGGCCGTCGCGGTCGCCGCCCGCTCCCTGTGCGTGCACGGCGACACCCCGAACGCCGCCCGGATCGCGGCCCGGGTGCGCGAGGCACTGGAGACGGCC
TRN  11011111101111111
NAM  Y333_MYCLE/3-244
ASQ  CIDLNADLGEGFGVWRLGD.-DEAMLRIVTSANVACGFHAGDPAGLLRVCRLAAERGVRIGAQVSYRDLVGFGRRFIDVTADDLLADVVYQIGALQAIAQTAGSAVSYVKPHGALYNTIVTNREQGAAVAAAIQLVDSTLPVLGLA---GSTFFD-----.--EAARIGLRTVAEAFADRTYRPDGQLISRREPGAVLHDPAVIAQRVV-TMVTTGKATAVDGTQLAVTVESICLHGDSPNAIQMATAVRDQLNAA
DSQ  TGTATCGACCTTAACGCCGACTTGGGTGAGGGCTTCGGCGTGTGGCGGCTCGGCGAC...---GATGAAGCCATGCTGCGGATCGTCACTAGCGCCAACGTGGCGTGCGGGTTCCACGCCGGAGATCCCGCCGGGCTGCTTAGGGTATGCCGGTTAGCAGCCGAACGTGGCGTGCGCATAGGAGCACAGGTGAGCTATCGCGACCTAGTCGGGTTCGGCCGACGATTCATCGACGTTACCGCCGACGATCTTCTCGCCGATGTAGTTTATCAGATCGGCGCATTGCAAGCGATCGCACAGACCGCCGGTTCCGCGGTGTCGTACGTAAAACCCCATGGAGCACTGTACAACACGATCGTGACCAACCGCGAACAAGGTGCCGCAGTCGCTGCGGCAATACAGCTGGTGGATTCCACGCTGCCAGTGCTGGGTTTGGCT---------GGTTCGACGTTTTTTGAC---------------...------GAGGCCGCGCGCATTGGCTTACGCACGGTAGCGGAGGCGTTCGCCGATCGAACCTACCGACCGGACGGTCAGCTGATTTCTCGGCGCGAACCCGGCGCGGTGTTGCACGACCCTGCGGTGATCGCGCAAAGAGTGGTA---ACCATGGTGACCACCGGTAAGGCCACTGCGGTCGACGGCACACAGCTTGCCGTCACCGTGGAATCGATTTGTTTGCATGGCGATTCCCCCAACGCTATACAGATGGCTACCGCGGTGCGCGATCAACTCAACGCCGCC
TRN  10010101100011010
NAM  YBGL_ECOLI/2-238
ASQ  KIDLNADLGEGCAS-----.-DAELLTLVSSANIACGFHAGDAQIMQACVREAIKNGVAIGAHPSFPDRENFGRSAMQLPPETVYAQTLYQIGALATIARAQGGVMRHVKPHGMLYNQAAKEAQLADAIARAVYACDPALILVGLA---GSELIR-----.--AGKQYGLTTREEVFADRGYQADGSLVPRSQSGALIENEEQALAQTL-EMVQHGRVKSITGEWATVAAQTVCLHGDGEHALAFARRLRSAFAEK
DSQ  AAAATTGACCTGAACGCCGATCTGGGCGAAGGCTGCGCCAGC---------------...---GACGCAGAGCTATTAACGCTGGTTTCCTCTGCCAATATTGCCTGTGGATTTCATGCAGGCGATGCGCAAATCATGCAGGCTTGCGTGCGTGAAGCAATAAAAAATGGTGTCGCGATTGGCGCTCACCCGAGTTTTCCCGACAGGGAAAATTTTGGTCGCAGCGCCATGCAGCTGCCGCCAGAAACCGTTTACGCCCAGACGCTGTATCAAATTGGCGCGCTGGCAACGATTGCCCGTGCGCAAGGCGGCGTAATGCGTCATGTCAAACCGCACGGCATGTTGTACAACCAGGCGGCGAAAGAAGCACAACTGGCAGACGCCATCGCCAGAGCGGTATACGCTTGCGATCCAGCATTGATTCTCGTCGGGCTGGCG---------GGAAGCGAGCTGATTCGT---------------...------GCAGGCAAGCAATATGGTCTGACAACGCGCGAGGAAGTGTTTGCCGATCGCGGTTATCAGGCTGACGGCTCGCTGGTGCCGCGAAGCCAGTCAGGCGCGTTGATTGAAAACGAAGAACAGGCGCTGGCGCAAACGCTG---GAGATGGTGCAACACGGCAGAGTCAAAAGTATCACCGGCGAATGGGCAACGGTCGCGGCGCAAACGGTCTGCCTGCATGGCGACGGCGAGCACGCACTGGCGTTCGCCCGCCGACTACGCTCTGCATTTGCCGAAAAG
TRN  10010101100011000
NAM  Y030_NEIMA/3-239
ASQ  QVDLNADLAEGCG-----S.-DEALLQLITSANIACAQHAGSIADIRAALAYAQQNGVRIGAHPGYPDRENFGRTEMNLSEADLRACLNYQLGALQALCRDQGLEMAYVKPHGAMYNQAAKNRALADTVARIVADFDPKLKLMALS---GSLLLE-----.--AGKAAGLGVISEVFADRRYMPDGTLVPRSRPDAQVDSDEEAIAQVL-QMVRDGQVKAVDGSLVAVQADSICLHGDGPHAVVFAEKIRQELLAA
DSQ  CAGGTTGATTTAAACGCCGATCTCGCCGAAGGCTGCGGC---------------AGC...---GACGAAGCCTTGTTGCAGCTGATTACTTCGGCCAACATCGCCTGCGCCCAACACGCCGGCAGCATTGCCGATATTCGGGCGGCATTGGCGTATGCCCAACAAAACGGCGTGCGCATCGGAGCACACCCCGGCTATCCCGATCGGGAAAACTTCGGCCGTACCGAAATGAATCTGTCCGAAGCCGATTTGCGGGCGTGTCTGAATTACCAGTTGGGCGCATTGCAGGCCTTGTGCCGTGATCAGGGTTTGGAAATGGCTTATGTCAAACCGCACGGCGCAATGTACAACCAAGCGGCGAAAAACCGTGCGCTGGCGGATACCGTTGCCCGAATTGTGGCGGATTTCGACCCGAAATTGAAATTGATGGCACTTTCC---------GGCAGCCTGCTCTTGGAA---------------...------GCCGGAAAAGCCGCAGGCTTGGGTGTGATTTCCGAAGTATTCGCCGACCGCCGCTATATGCCCGACGGTACGCTGGTTCCCCGCAGCCGCCCCGATGCGCAGGTGGACAGCGACGAAGAAGCCATCGCCCAAGTATTG---CAGATGGTGCGGGACGGGCAGGTCAAAGCAGTGGACGGCAGCCTGGTTGCCGTGCAAGCCGACAGCATCTGTCTGCACGGAGACGGGCCGCACGCCGTGGTGTTTGCCGAAAAAATCCGGCAGGAACTACTGGCGGCA
TRN  11011101101011010
NAM  Y1729_HAEIN/3-239
ASQ  KIDLNADIAEGFP------.FDESLLQLLSSANVACGLHAGGAKEMQSAVKFAKENKVRIGAHPSFPDRENFGRTAMALSSQELIAHLRYQLGALKAICDGEGAVISYVKPHGALYNQAAKDEKIARLIAQTVYQFDPNLKLMGLA---GSLMLR-----.--IAEEEKLQTISEVFADRHYMPDGSLVPRSQPNAMVESDKEAIQQVL-QMVTKGQVNAIDGSLVPVKAESICLHGDNQHSLQFAKRIVEELEKN
NAM  Y1541_CAMJE/3-244
ASQ  KVDLNSDLGESFGAYKMGM.-DEEILKFVSSVNVACGFHAGDPCVMDETLNLAKQNGVCIGAHPSYPDLLGFGRRNMQISFEEAKNYALYQLGALFGFAKAKGMKIQHFKAHGALYNMAAIDENLALALCEAVASFDENIIFLGLS---NSAMNE-----.--AAKKKGLRYANEVFADRAYNDDGTLVSRKLEGALIHDENLAIKRVI-KMIKESKVTSINGKEIDLKADSICVHGDNAKALEFVKKIKENLKKE
DSQ  AAAGTGGATTTAAATAGTGATTTAGGGGAAAGTTTTGGCGCCTATAAAATGGGAATG...---GATGAAGAAATTTTAAAATTTGTAAGTTCAGTAAATGTCGCTTGTGGCTTTCATGCGGGTGATCCTTGTGTGATGGATGAAACCTTAAATTTAGCCAAGCAAAATGGTGTTTGCATAGGAGCACATCCATCTTATCCTGATCTTTTGGGTTTTGGAAGACGCAATATGCAAATAAGCTTTGAAGAGGCTAAAAACTATGCCTTGTATCAACTAGGAGCTTTATTTGGCTTTGCTAAGGCAAAAGGTATGAAAATACAGCATTTTAAAGCCCATGGGGCGCTTTATAATATGGCAGCTATTGATGAAAATTTAGCCTTAGCACTTTGTGAGGCAGTGGCGAGTTTTGATGAAAATATTATTTTTCTAGGGCTTAGT---------AATTCTGCTATGAATGAA---------------...------GCAGCTAAGAAAAAGGGTTTAAGATATGCTAATGAAGTTTTTGCAGATCGTGCCTATAATGATGATGGCACTTTAGTTTCAAGAAAATTAGAAGGGGCGTTAATACACGATGAAAATTTAGCTATCAAACGCGTGATA---AAAATGATAAAAGAAAGCAAAGTTACAAGCATAAATGGCAAAGAAATTGATTTAAAAGCCGATAGTATTTGTGTTCATGGGGATAATGCAAAAGCTTTAGAATTTGTTAAAAAAATCAAAGAAAATTTAAAAAAAGAG
TRN  10010101110011000
NAM  Y986_PYRHO/2-243
ASQ  RVDLNSDLGESFGRYKLGL.-DEEVMKYITSANVACGWHAGDPLVMRKTVRLAKENDVQVGAHPGYPDLMGFGRRYMKLTPEEARNYILYQVGALYAFAKAEGLELQHVKPHGALYNAMVKEEDLARAVIEGILDFDKDLILVTLS---NSRVAD-----.--IAEEMGLKVAHEVFADRAYNPDGTLVPRGRPGAVIEDKEEIAERVI-SMVKDGGIRAINGEWVDLKVDTICVHGDNPKAVEITSYIRKVLEEE
DSQ  AGGGTTGATCTGAATTCAGACCTCGGTGAAAGTTTTGGAAGGTACAAGCTTGGTTTA...---GATGAAGAAGTAATGAAGTACATCACCTCGGCGAACGTGGCTTGTGGTTGGCATGCTGGGGATCCCCTAGTTATGAGGAAAACAGTTAGACTAGCCAAGGAGAATGATGTTCAAGTTGGAGCACACCCAGGATATCCCGACTTAATGGGCTTCGGGAGGAGGTATATGAAGCTGACCCCGGAAGAAGCTAGGAACTACATCCTTTATCAAGTCGGTGCATTGTATGCATTTGCCAAAGCTGAGGGGCTCGAGTTGCAACACGTCAAGCCCCATGGGGCACTATATAATGCCATGGTCAAGGAGGAAGACTTAGCTAGAGCTGTTATAGAGGGAATACTCGATTTTGATAAGGATCTAATCCTCGTAACGCTCTCT---------AATTCTAGAGTAGCAGAT---------------...------ATTGCTGAGGAGATGGGGCTTAAGGTAGCCCACGAAGTGTTCGCTGATAGGGCCTACAATCCAGACGGTACCCTAGTTCCCAGGGGAAGACCAGGGGCCGTTATAGAGGATAAGGAAGAGATAGCTGAAAGGGTAATT---TCAATGGTTAAAGATGGGGGAATTAGAGCGATAAATGGAGAGTGGGTGGATCTTAAGGTTGACACGATATGCGTTCACGGGGACAATCCAAAAGCTGTAGAGATAACATCCTACATAAGGAAAGTTCTGGAAGAGGAG
TRN  10010101100011000
NAM  Y1605_STAAM/2-243
ASQ  RVDLNCDLGEAFGNYSFGG.-DHQIIPLITSANVACGFHAGDENVMNETVKLAKAHNVAVGAHPGLPDLKGFGRRNIDISNDEIYNLMIYQLGALQGFCRIHQLKINHVKPHGALYQMGAKDREIANVIAQAVYDFDPSLVLVGLA---NSYLIS-----.--EAKNVGLITASEVFADRRYEDDGQLVSRKESDAVITDTDEALKQVL-KMVKENKVISKNNKEVTLQADTICVHGDGEHALLFVSKIREILMKE
DSQ  CGAGTTGATTTGAATTGTGATTTAGGCGAAGCATTTGGAAATTATTCCTTTGGTGGT...---GATCATCAAATTATTCCGTTAATTACAAGTGCGAATGTTGCTTGTGGTTTTCACGCTGGTGATGAAAATGTAATGAATGAAACGGTAAAACTTGCCAAAGCACATAATGTTGCAGTAGGTGCACATCCTGGTTTACCTGATTTGAAAGGCTTTGGCAGACGAAATATAGATATCTCTAACGACGAGATTTATAATTTGATGATTTATCAATTAGGTGCATTACAAGGGTTTTGTCGCATTCATCAACTTAAAATTAATCATGTTAAACCGCATGGTGCATTGTATCAGATGGGTGCAAAAGACAGAGAAATAGCAAACGTTATAGCACAAGCTGTTTATGACTTTGATCCATCACTAGTGTTAGTAGGATTAGCA---------AATTCATATCTAATTTCA---------------...------GAAGCAAAGAATGTCGGATTAATTACAGCTTCTGAAGTGTTTGCTGATAGACGATACGAAGATGATGGGCAGCTCGTTAGTAGAAAAGAAAGTGATGCTGTGATTACTGATACTGACGAAGCACTTAAGCAGGTTTTA---AAGATGGTGAAGGAAAATAAAGTTATTTCAAAAAACAATAAGGAAGTAACGTTACAAGCAGATACAATTTGTGTGCATGGTGATGGAGAACATGCATTATTATTTGTTTCGAAAATTAGAGAAATTTTAATGAAAGAA
TRN  10010101110011000
NAM  Y1821_BACHD/3-244
ASQ  RVDLNSDLGESFGAYTIGQ.-DDRVLEHVTSANIACGYHAGDHNVMARTVKLAADKGMGIGAHPGFPDLLGFGRRNIQTDHKDIYNFIVYQVAALNGFCQLHRVRMQHVKPHGALYNMAAKDRVIAEAIAEAIYDIDPSLILFGLS---GSELIK-----.--AGKKLGLTVANEVFADRTYQPDGTLTPRSEANALIKESERATEQVI-QMVKESKVIAVDGSHIPIEADTICVHGDSPTALSFIERLHAQLQVE
DSQ  CGTGTAGATTTGAATAGTGATCTTGGTGAAAGCTTTGGCGCATATACGATTGGTCAG...---GATGATCGTGTCCTTGAACATGTGACTTCTGCCAACATTGCTTGTGGCTACCATGCTGGAGATCACAATGTCATGGCGCGTACGGTCAAGCTCGCGGCTGACAAGGGAATGGGAATTGGCGCTCATCCTGGCTTTCCCGATTTACTCGGGTTTGGCAGACGAAACATCCAAACAGATCATAAAGATATTTACAACTTTATCGTGTACCAAGTCGCTGCACTAAACGGTTTTTGCCAGTTGCATCGTGTACGGATGCAGCATGTGAAGCCTCATGGGGCTCTTTATAATATGGCAGCGAAAGACCGCGTGATCGCCGAGGCGATTGCCGAGGCCATTTACGATATTGATCCTAGCTTAATTTTATTTGGTCTTTCC---------GGAAGTGAGTTAATAAAG---------------...------GCTGGGAAAAAGCTCGGTCTAACCGTTGCCAATGAAGTGTTCGCTGACCGTACGTACCAACCCGATGGCACACTGACGCCGAGGAGTGAAGCGAATGCCCTGATCAAAGAAAGTGAACGAGCGACCGAACAAGTGATT---CAAATGGTGAAAGAAAGCAAGGTAATCGCTGTCGACGGAAGTCACATTCCGATTGAGGCAGATACGATTTGCGTACATGGTGATAGTCCAACCGCCCTTTCATTTATTGAGCGATTGCACGCACAATTACAGGTAGAA
TRN  10010101100011000
NAM  Y150_BORPE/4-245
ASQ  AIDLNCDMGESYGAWRMGN.-DEAVLQFVTSANIACGFHGGDPSTMRQTVAAALAHGVALGAHPSLPDLAGFGRRAMQITPQEAYDLVVYQVGALAGVAASQGARLHHVKAHGALYNMAAKDAALARAICQAVRDVDSDLVLYGLA---GSALID-----.--AARAIGLRAAQEVFADRTYQADGQLTPRSQPDAMITDLDQAIAQVL-GMVRDGSVRTPDGQTVALQADTLCIHGDQPDALVFARGIRLALERD
DSQ  GCCATCGACCTGAATTGCGACATGGGCGAAAGCTACGGCGCCTGGCGCATGGGCAAC...---GACGAAGCCGTGCTGCAGTTCGTCACGTCGGCCAATATCGCCTGTGGCTTTCACGGCGGCGACCCATCCACCATGCGCCAGACCGTCGCCGCGGCGCTGGCCCATGGGGTGGCGCTGGGCGCTCACCCCAGCCTGCCGGACCTGGCCGGCTTCGGGCGCCGCGCCATGCAGATCACCCCGCAGGAAGCCTACGACCTGGTGGTCTACCAGGTCGGCGCGCTGGCCGGCGTGGCCGCCTCGCAAGGCGCGCGCCTGCATCACGTCAAGGCGCACGGCGCGCTCTACAACATGGCGGCCAAGGATGCGGCGCTGGCGCGCGCGATCTGCCAGGCGGTGCGCGATGTCGACAGCGACCTGGTGCTGTACGGGCTGGCC---------GGCAGCGCCTTGATCGAC---------------...------GCTGCCCGCGCCATCGGCCTGCGCGCGGCGCAGGAAGTCTTCGCCGACCGGACCTACCAGGCCGACGGCCAATTGACGCCGCGCAGCCAGCCCGACGCCATGATCACCGACCTGGACCAGGCCATCGCCCAGGTGCTG---GGCATGGTGCGCGACGGCAGCGTGCGCACGCCCGACGGACAGACCGTGGCCTTGCAGGCCGATACGCTGTGCATCCACGGCGACCAGCCCGATGCGCTGGTATTCGCCCGCGGCATCCGCCTGGCGCTCGAACGCGAC
TRN  11011111101111111
NAM  LAMB_EMENI/7-254
ASQ  KALINCDMGEAYGNWTCGP.-DLELLPLIDIANIACGFHAGDPLIMMETVRNCKAHNILVGAHPGLPDIQGFGRREMKLSPEELTAITIYQVGALQGFLDREGVRLNHVKPHGVLYGMMCRDYEVAKAVMLGIPKGSLCSAYQGPTWKRLPMIWELNFELsSMVMSSTTLTECLSLTARRSH---GTL--RMWRSMSGNSLRISLSRALMELSCRCRLKIMMCPFVVIPIRLAVLKSSRQRRKWWTNSIRS-MDFE
DSQ  AAAGCTCTAATCAACTGCGACATGGGAGAAGCGTACGGGAACTGGACTTGTGGGCCG...---GATCTAGAGCTTCTCCCGTTAATTGACATAGCCAACATCGCGTGTGGTTTCCACGCTGGCGATCCTTTGATCATGATGGAAACAGTACGGAACTGTAAAGCCCACAATATTTTGGTGGGTGCCCATCCCGGCTTACCGGACATCCAAGGGTTCGGACGGCGCGAAATGAAGCTATCCCCGGAAGAGCTCACTGCGATCACTATCTACCAAGTGGGAGCTCTCCAAGGCTTCCTGGATCGCGAAGGGGTGCGCCTGAACCATGTTAAGCCTCATGGTGTCCTTTATGGTATGATGTGCAGGGATTATGAGGTGGCAAAGGCCGTCATGCTGGGGATTCCCAAGGGATCCCTGTGTTCGGCTTACCAGGGACCAACATGGAAAAGGCTGCCAATGATCTGGGAATTGAATTTCGAGCTGagtTCTATGGTGATGTCAAGTACGACTCTAACGGAATGCTTGTCATTGACCGCAAGAAGAAGCCAT---------GGGACCCTG------CGGATGTGGAGAAGCATGTCCGGCAACAGCTTGAGGATCAGTCTGTCACGAGCGTTGATGGAGTTGTCGTGCCGCTGCCGATTAAAGATTATGATGTGTCCATTTGTTGTCATTCCGATTCGCCTGGCTGTCTTGAAATCATCAAGACAACGAAGAAAGTGGTGGACGAATTCAATAAGAAGT---ATGGATTTTGAA
TRN  10010101100011000
//