EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03723 - Hemocyanin_C)
FAM  PF03723
PID  Hemocyanin_C
DES  Hemocyanin, ig-like domain
IPR  IPR005203
ANO  14
ALN  266
AID  0.346754
APH  ((((HCYE_EURCA/374-620:0.38031,HCY6_ANDAU/376-625:0.17419):0.08864,HCYD_EURCA/376-622:0.37448):0.07106,((HCYC_PANIN/405-655:0.56879,HCYA_PANIN/399-652:0.26531):0.58816,(ARY1_CALVI/485-736:0.56388,((JSB2_TRINI/446-699:0.33769,(JSB1_TRINI/445-698:0.29938,SSP1_BOMMO/448-700:0.21256):0.32063):0.30814,(ARYA_MANSE/449-682:0.26382,(ARYB_MANSE/446-680:0.13635,SSP2_BOMMO/446-678:0.43346):0.10986):0.48133):0.24068):0.50843):0.36034):0.06788,HCYA_EURCA/380-629:0.33165,HCY2_LIMPO/379-627:0.35744);
ATP  ((((HCYE_EURCA/374-620,HCY6_ANDAU/376-625),HCYD_EURCA/376-622),((HCYC_PANIN/405-655,HCYA_PANIN/399-652),(ARY1_CALVI/485-736,((JSB2_TRINI/446-699,(JSB1_TRINI/445-698,SSP1_BOMMO/448-700)),(ARYA_MANSE/449-682,(ARYB_MANSE/446-680,SSP2_BOMMO/446-678)))))),HCYA_EURCA/380-629,HCY2_LIMPO/379-627);
ATL  7.84446
DNO  9
DLN  798
DID  0.475926
DPH  (SSP2_BOMMO/446-678:0.33975,ARYB_MANSE/446-680:0.16434,(((ARY1_CALVI/485-736:0.31743,(HCYE_EURCA/374-620:0.23375,(HCYD_EURCA/376-622:0.29374,HCYA_EURCA/380-629:0.31453):0.07190):0.45672):0.14524,(JSB1_TRINI/445-698:0.21390,SSP1_BOMMO/448-700:0.20876):0.29870):0.23449,ARYA_MANSE/449-682:0.20086):0.05560);
DTP  (SSP2_BOMMO/446-678,ARYB_MANSE/446-680,(((ARY1_CALVI/485-736,(HCYE_EURCA/374-620,(HCYD_EURCA/376-622,HCYA_EURCA/380-629))),(JSB1_TRINI/445-698,SSP1_BOMMO/448-700)),ARYA_MANSE/449-682));
DTL  3.54971
RID  0.357413
RPH  ((((((SSP2_BOMMO/446-678:0.42984,ARYB_MANSE/446-680:0.13666):0.09331,ARYA_MANSE/449-682:0.28151):0.45643,(JSB1_TRINI/445-698:0.38723,SSP1_BOMMO/448-700:0.11620):0.53016):0.24413,ARY1_CALVI/485-736:0.56271):0.79416,HCYE_EURCA/374-620:0.34988):0.09098,HCYA_EURCA/380-629:0.41880,HCYD_EURCA/376-622:0.31111);
RTP  ((((((SSP2_BOMMO/446-678,ARYB_MANSE/446-680),ARYA_MANSE/449-682),(JSB1_TRINI/445-698,SSP1_BOMMO/448-700)),ARY1_CALVI/485-736),HCYE_EURCA/374-620),HCYA_EURCA/380-629,HCYD_EURCA/376-622);
RTL  5.20311
LNK  ARY1_CALVI/485-736:P28513:X59391
LNK  ARYA_MANSE/449-682:P14296:M28394
LNK  ARYB_MANSE/446-680:P14297:M28395
LNK  HCY2_LIMPO/379-627:P04253:
LNK  HCY6_ANDAU/376-625:P80476:
LNK  HCYA_EURCA/380-629:P14750:X16893
LNK  HCYA_PANIN/399-652:P04254:
LNK  HCYC_PANIN/405-655:P80096:
LNK  HCYD_EURCA/376-622:P02241:AJ290430
LNK  HCYE_EURCA/374-620:P02242:X16894
LNK  JSB1_TRINI/445-698:Q06342:L03280
LNK  JSB2_TRINI/446-699:Q06343:
LNK  SSP1_BOMMO/448-700:P09179:X12978
LNK  SSP2_BOMMO/446-678:P20613:M24370
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  SSP2_BOMMO/446-678
ASQ  KPYTQDKLYFDGVKITDVKVDKLTTFFENFEFDASNSV--YFSKEEIKNN-HVHELRCAT-RLNHSPFNVNIEVDS--NVASDAVVKMLLAPKYDDNGIPLTLEDNWMKFFELDWFTTKLTAGQNKIIRNSNEFVIFKEDSVPMTEIMKMLDEGKVP.---FDMSEEFCY----MPKRLMLPRGTEGGFPFQLFVFVYPFD-------------NKGKDLAPF.E-SFVLDNNLLASLWIAPLL--MHYSRFL-TCISR-IFSFTT
DSQ  AAGCCTTACACTCAAGACAAACTTTACTTTGATGGTGTCAAGATAACTGATGTTAAAGTCGACAAATTGACAACATTCTTCGAGAACTTTGAATTCGACGCCAGCAACAGCGTG------TACTTTAGTAAGGAGGAGATTAAGAACAAT---CACGTCCATGAGTTAAGGTGCGCCACA---CGATTGAACCACAGCCCCTTCAACGTTAACATTGAGGTTGATTCT------AATGTCGCCAGTGACGCTGTTGTCAAAATGTTGCTGGCCCCCAAATACGATGACAACGGAATACCTCTCACATTAGAGGACAACTGGATGAAATTCTTCGAGTTGGACTGGTTCACAACTAAACTCACCGCTGGTCAGAACAAGATTATCCGCAATTCGAATGAATTTGTCATATTTAAAGAAGACTCCGTGCCAATGACTGAAATTATGAAGATGCTCGACGAAGGAAAAGTACCT...---------TTTGATATGTCGGAAGAGTTCTGTTAC------------ATGCCTAAAAGACTCATGCTGCCTAGAGGTACTGAAGGTGGATTCCCATTCCAGCTCTTTGTTTTCGTCTATCCATTCGAC---------------------------------------AACAAAGGCAAGGACTTGGCTCCTTTC...GAA---TCTTTTGTTCTTGACAATAACCTCTTGGCTTCCCTCTGGATCGCCCCGTTGTTG------ATGCATTATTCAAGGTTCCTA---ACATGTATTTCAAGG---ATATTTTCATTTACCACG
TRN  10010101100011000
NAM  ARYB_MANSE/446-680
ASQ  QPYSSEKLAFKGVKVVDVVVDKLVTFFEYYDFDASNSV--FWSKEEVKSS-YPHDFKIRQPRLNHKPFSVSIDIKS--EAAVDAVVKIFMAPKYDDNGFPLKLENNWNKFFELDWFTYKFVAGDNKIVRNSNDFLIFKDDSVPMTELYKLLEQNKVP.---HDMSEDYGY----LPKRLMLPRGTEGGFPFQFFVFVYPFN-------------ADSKDLAPF.E-AFIQDNKPLGYPFDRPVV--DAYFKQH-NMFFKDVFVYHD
DSQ  CAACCGTACTCTTCAGAAAAACTGGCATTCAAGGGTGTCAAGGTGGTCGATGTTGTAGTAGACAAACTGGTTACCTTCTTCGAGTACTACGACTTTGATGCGTCCAACAGCGTT------TTCTGGAGCAAAGAGGAGGTTAAATCTAGC---TACCCCCATGATTTCAAGATCCGTCAGCCACGCCTTAACCACAAGCCATTCTCTGTCTCTATCGACATCAAATCT------GAAGCTGCCGTTGATGCCGTTGTCAAGATATTCATGGCACCTAAATACGACGATAATGGATTCCCTCTGAAATTAGAAAACAACTGGAACAAATTCTTCGAGCTGGACTGGTTCACATACAAATTTGTTGCTGGTGACAACAAAATCGTGAGGAACTCAAACGACTTCTTGATCTTCAAGGACGACTCTGTTCCCATGACTGAGTTGTACAAATTATTAGAACAAAATAAGGTTCCA...---------CACGACATGTCCGAGGATTACGGCTAC------------CTGCCTAAAAGACTGATGCTGCCAAGAGGTACTGAGGGTGGCTTCCCATTCCAGTTCTTCGTTTTCGTATATCCATTCAAC---------------------------------------GCTGACAGCAAAGATCTTGCACCGTTC...GAG---GCCTTCATCCAGGACAACAAACCTTTGGGCTATCCATTCGACCGTCCCGTTGTT------GACGCTTACTTCAAGCAACAC---AACATGTTCTTCAAGGACGTCTTCGTATACCATGAC
TRN  10010101100011000
NAM  ARYA_MANSE/449-682
ASQ  QPYNQNDLHFVGVKISDVKVDKLATYFEYYDFDVSNSV--FVSKKDIKN--FPYGYKVRQPRLNHKPFSVSIGVKS--DVAVDAVFKIFLGPKYDSNGFPIPLAKNWNKFYELDWFVHKVMPGQNHIVRQSSDFLFFKEDSLPMSEIYKLLDEGKIP.---SDMSNSSDT----LPQRLMLPRGTKDGYPFQLFVFVYPYQ-------------AVPKEMEPF.K-SIVPDSKPFGYPFDRPVH--PEYFKQP-NMHFEDVHVYHE
DSQ  CAGCCCTACAACCAAAACGATTTGCACTTCGTTGGTGTAAAGATTAGCGACGTCAAAGTAGACAAATTGGCCACATACTTCGAATATTACGACTTTGACGTCAGCAACAGCGTA------TTTGTAAGCAAGAAGGACATCAAGAAC------TTCCCCTACGGTTACAAGGTCCGTCAGCCCCGCCTTAATCACAAACCATTCTCTGTCTCCATCGGCGTCAAATCT------GATGTTGCTGTTGATGCAGTTTTCAAGATTTTCTTAGGTCCTAAATACGACAGCAATGGCTTCCCAATTCCATTGGCTAAGAACTGGAATAAATTCTACGAACTGGATTGGTTCGTGCACAAGGTCATGCCTGGGCAGAACCACATCGTCCGCCAGTCCAGTGACTTCCTATTCTTTAAGGAGGACTCTCTGCCCATGTCTGAGATCTACAAACTGCTTGACGAAGGCAAAATACCC...---------TCTGACATGTCAAACTCATCCGACACG------------CTGCCTCAGAGATTGATGCTGCCAAGAGGTACCAAGGACGGTTATCCATTCCAATTGTTCGTGTTCGTGTACCCGTACCAG---------------------------------------GCTGTGCCTAAGGAGATGGAGCCATTC...AAG---TCGATTGTGCCAGACAGCAAGCCTTTCGGATATCCGTTCGACCGCCCCGTCCAC------CCTGAATACTTCAAGCAGCCC---AACATGCACTTCGAGGATGTGCACGTTTACCACGAG
TRN  10010101100011000
NAM  SSP1_BOMMO/448-700
ASQ  PKYTREQFSFPGVKVEKITTDELVTFVDEYDMDISNAM--YLDATEMQNKTSDMTFMARMRRLNHHPFQVSIDVMS--DKTVDAVVRIFLGPKYDCMGRLMSVNDKRLDMFELDSFMYKLVNGKNTIVRSSMDMQGFIPEYLSTRRVMESEMMPSG-.DGQTMVKDWWCKSRNGFPQRLMLPLGTIGGLEMQMYVIVSPVR--TGM-LLPTLDMTMMKDRCAC.RWSSCISTMPLGYPFDRPID--MASFFTS-NMKFADVMIYRK
DSQ  CCGAAATATACTCGCGAACAGTTCAGCTTCCCCGGAGTCAAAGTGGAGAAAATTACCACCGATGAGCTGGTCACATTCGTTGATGAGTACGACATGGACATTAGCAACGCTATG------TACCTGGACGCAACTGAGATGCAGAACAAGACATCCGATATGACCTTTATGGCCCGCATGCGCCGCCTCAATCACCATCCGTTCCAGGTGTCGATTGATGTCATGTCC------GACAAAACTGTCGATGCTGTGGTCCGCATCTTCCTGGGTCCCAAGTACGACTGCATGGGCAGGCTCATGAGCGTCAACGACAAACGCCTCGACATGTTCGAGCTGGACAGCTTTATGTACAAACTGGTCAACGGAAAGAACACCATCGTCCGTAGCTCCATGGATATGCAAGGATTTATCCCAGAGTACCTTTCGACTCGTCGTGTAATGGAAAGCGAAATGATGCCTTCCGGA---...GATGGCCAGACAATGGTCAAGGACTGGTGGTGCAAGTCTCGCAACGGATTCCCTCAGAGACTTATGCTGCCCCTCGGTACGATTGGAGGTTTGGAGATGCAGATGTACGTCATCGTGTCGCCGGTCCGC------ACCGGTATG---CTCTTGCCCACATTGGACATGACCATGATGAAGGACCGTTGTGCTTGT...CGCTGGAGCTCATGTATCTCCACCATGCCTCTCGGATATCCATTTGACAGACCGATTGAC------ATGGCGAGCTTCTTCACTAGC---AACATGAAGTTCGCTGACGTAATGATCTACAGAAAA
TRN  10010101100011001
NAM  JSB1_TRINI/445-698
ASQ  PKYTREDFDFPGVKIEKFTTDKLTTFIDEYDMDITNAM--FLDDVEMKKKRSDMTMVARMARLNHHPFKVTVDVTS--DKTVDCVVRIFIGPKYDCLGRLMSVNDKRMDMIEMDTFLYKLETGKNTIVRNSLEMHGVIEQRPWTRRILNNMIGTVGTiSKTVDVESWWYK-RHRLPHRMLLPLGRRGGMPMQMFVIVTPVK--TNL-LLPNLDMNIMKERKTC.AGASVSTRCRSGFPFDRKID--MTHFFTR-NMKFTDVMIFRK
DSQ  CCTAAGTACACCCGCGAGGACTTCGACTTCCCCGGTGTTAAAATCGAGAAGTTCACCACCGACAAACTCACCACCTTCATCGATGAATACGACATGGACATCACCAACGCCATG------TTCCTTGACGATGTTGAGATGAAGAAGAAGCGCTCTGACATGACCATGGTTGCCCGCATGGCCCGCCTCAACCACCACCCCTTCAAGGTCACCGTTGATGTCACCTCC------GACAAGACTGTCGACTGTGTTGTCCGCATCTTCATCGGTCCCAAATACGACTGCCTCGGCCGCCTCATGAGCGTCAACGACAAACGCATGGACATGATTGAAATGGACACCTTCTTGTACAAACTGGAGACTGGAAAGAACACCATCGTCCGCAACTCCCTGGAGATGCACGGTGTCATCGAGCAGAGGCCATGGACCCGCCGCATTCTCAACAACATGATCGGCACAGTCGGAACTatcAGCAAGACCGTCGACGTTGAGAGCTGGTGGTACAAG---AGGCATCGGCTTCCGCACAGGATGCTCCTGCCCCTGGGTCGCCGCGGTGGCATGCCCATGCAGATGTTCGTCATCGTCACCCCCGTCAAG------ACCAACCTG---CTCCTCCCCAACCTGGACATGAACATCATGAAGGAACGCAAGACTTGT...GCTGGAGCGTCTGTTTCGACACGATGCCGCTCCGGCTTCCCCTTCGACAGGAAGATCGAT------ATGACTCACTTCTTCACTCGT---AACATGAAGTTCACCGATGTGATGATCTTCAGGAAG
TRN  10010101100011011
NAM  JSB2_TRINI/446-699
ASQ  PSYTKEDLYFPGVKIDNVVVDKLVTYFDDYLMDMTNAV--YLTEDEIKKTKSDMVFMVRKRRLNHQPFKVTLDILS--DKSVDCVVRVFLGPKKDNLNRLIDINRNRLNFVELDTFLYKLNTGKNTIVRNSYDMHNLVKDRMMTRDFMKKVESITD-.MRDLMIKDLRNY-HTGFPTRLLLPKGFVGGMHMMLYVIVTPLRLVDNV-DINILDINRKDLMRDF.RSTVLLDKMPLGFPFDRRID--VGNFFTP-NMKFVEVTIFHK
NAM  ARY1_CALVI/485-736
ASQ  KPYTHEELLFPGVTIKDVKVSELVTYFDLVDFDVTNLMNDEMTFVDGQFV-WDKTLLARQMRLNHKPFDFDFVIES--DKSHKVVIRTFLGPKYDEFGRVITLTENRQNFMEIDSFIYTLKSGVNDFKRLSKDFYWTVEDRTTYNELYKYVMLALQG.--KYDFPLDISEPHCGFPDRLVLPHGWYKGMPMQFFFYIAPYTASYGP-----FSTYDSTYACGIgSGVRHIDEMPFGYPFDREID--EYEFFVP-NMYFKDVKIYHQ
DSQ  AAGCCCTACACTCACGAAGAATTGTTGTTCCCTGGTGTTACCATAAAGGACGTTAAGGTTTCTGAATTGGTTACCTACTTCGATTTGGTCGACTTTGATGTCACCAACTTGATGAACGATGAGATGACTTTCGTTGATGGTCAATTCGTT---TGGGACAAGACCTTGTTGGCACGTCAAATGCGCCTCAACCACAAGCCTTTCGACTTCGATTTCGTTATTGAATCT------GACAAATCCCACAAGGTTGTTATCCGCACTTTCTTGGGTCCCAAATACGACGAATTCGGCCGTGTCATCACATTGACTGAAAACCGTCAAAACTTCATGGAAATTGACAGCTTCATCTACACCCTTAAATCTGGTGTCAATGAGTTCAAACGCCTCTCCAAGGACTTTTACTGGACCGTTGAGGACCGCACCACCTACAATGAATTGTACAAGTATGTCATGCTTGCTTTGCAAGGC...------AAATACGACTTCCCCTTGGACATCAGCGAACCCCATTGTGGTTTCCCCGATCGTTTGGTTTTGCCCCATGGTTGGTACAAGGGTATGCCCATGCAATTCTTCTTCTACATTGCACCCTACACTGCCTCCTACGAACCC---------------TTCTCCACTTACGACTCCACTTACGCTTGCGGTATTggcTCTGGCGTTCGTCATATCGATGAAATGCCTTTCGGTTATCCCTTCGATCGTGAAATCGAC------GAATACGAATTCTTCGTACCC---AACATGTACTTCAAGGATGTCAAGATCTACCACCAA
TRN  10010101110011011
NAM  HCYE_EURCA/374-620
ASQ  PHYTPEDLTCPGVHVVNVTVNAKVPNVVTTFMKEA-----ELELSYGIDFGSDHSVKVLYRHLDHEPFTYNISVENSSGGAKDVTMRIFLGPKYDELGNRLQPEQQRTLNIELDKFKATLDPGKNVVTRDHRNSTVTVEQSVPVKKLREEGGVAG--.----------EYCSCGWPEHMLIPKGNHRGMDFELFVIVTDYAQDAVNGHGENAECVDAVSYCGA.KDQKYPDKKPMGFPFDRVIEGLTFEEFLTVSMSCTDVRIKYT
DSQ  CCTCATTACACTCCAGAAGATTTGACATGTCCAGGAGTTCACGTAGTCAACGTAACAGTGAATGCCAAGGTTCCAAATGTGGTAACAACTTTCATGAAGGAAGCT---------------GAACTGGAACTCTCATATGGCATCGACTTCGGAAGTGACCATTCTGTGAAGGTACTGTACCGCCACTTGGATCACGAACCCTTCACTTACAACATCAGCGTCGAGAACTCATCTGGTGGTGCTAAGGACGTGACAATGCGTATTTTCCTCGGCCCTAAGTATGACGAATTGGGCAACCGTCTGCAACCAGAACAGCAGAGGACCCTGAACATCGAACTGGACAAGTTCAAGGCCACTCTCGACCCTGGTAAGAACGTCGTCACACGTGACCACCGTAATTCAACTGTAACTGTTGAACAAAGCGTCCCAGTAAAGAAACTGCGTGAGGAAGGAGGCGTTGCTGGA------...------------------------------GAATACTGCAGCTGCGGATGGCCTGAACACATGCTCATCCCCAAAGGAAACCACAGGGGCATGGACTTCGAACTCTTCGTCATTGTAACAGACTACGCTCAGGATGCTGTCAACGGACACGGAGAAAATGCCGAATGTGTGGATGCTGTGAGCTACTGCGGAGCC...AAGGACCAGAAGTATCCTGACAAGAAGCCCATGGGATTCCCATTCGATAGAGTCATCGAAGGATTGACCCTTGAAGAATTTCTAACTCCGAGCATGAGCTGCACTGATGTCAGGATTAAGTACACC
TRN  10010101100011001
NAM  HCY6_ANDAU/376-625
ASQ  HPYTKEELSFPGVEVVGVSINSKTANVITTLIKES-----LLELSHGINFGTDQSVKVKYHHLDHEPFTYNIVVENNSGAEKHSTVRIFLAPKYDELNNKLEPDEQRRLFIELDKFFYTLTPGKNTIVRNHQDSSVTISKVRTFDQLGAGEGVSED-.--------STEYCSCGWPEHMLIPRGSHKGMEFELFVMLTDHDEDTVAGLSENAVCSDAVSYCGA.RDDRYPDKKAMGFPFDRKIEARTAAEFLTPNMGLTDIKIKFH
NAM  HCYD_EURCA/376-622
ASQ  PSYTHQQLDFPGVRISRVTVRSKVPNLIHTYSKDS-----LLELSHGINL-KGH-IQVKYEHLDHEPYNYEIEVDNRTGEARETCVRIFLAPKYDELGNRLILEEQRRLYIELDKFHRRLEPGKNVLVRASGDSSVTLSKVPTFEELESGNANVNP-.--------N-EYCSCGWPEHMLVPRGKERGMDFYLFVMLTDYEEDKVQGAGEQTICSDAVSYCGA.KDQKYPDKKAMGYPFDRPIQVRTPSQFKTPNMAFQEIIIQYE
DSQ  CCAAGCTACACTCACCAGCAGTTGGACTTCCCAGGAGTTCGTATATCAAGGGTGACTGTGAGGAGCAAAGTTCCGAATCTTATCCACACCTACTCCAAGGATTCC---------------CTTCTCGAACTGTCCCACGGAATCAACCTC---AAAGGGCAC---ATTCAGGTCAAATATGAACACTTGGACCACGAACCATACAACTACGAGATCGAGGTAGACAACAGGACCGGTGAGGCCAGGGAAACCTGTGTTCGAATCTTTTTGGCTCCCAAGTACGATGAATTGGGCAACCGACTGATCCTGGAAGAGCAACGAAGACTGTACATAGAACTGGACAAGTTCCATCGCAGACTGGAACCAGGCAAGAATGTGCTGGTTAGAGCATCAGGAGATTCCTCAGTAACTCTGTCGAAAGTACCAACTTTCGAAGAATTGGAATCTGGCAATGCTAACGTCAACCCG---...------------------------AAC---GAGTACTGCAGTTGTGGATGGCCTGAGCACATGCTCGTACCCCGAGGAAAGGAAAGGGGAATGGACTTCTATTTGTTCGTCATGCTTACCGATTATGAGGAAGATAAGGTTCAGGGTGCCGGAGAACAGACCATCTGCTCGGACGCCGTAAGTTACTGTGGAGCC...AAGGACCAGAAATATCCTGATAAGAAGGCTATGGGTTATCCCTTCGATCGTCCCATCCAGGTCCGTACCCCAAGTCAGTTCAAGACACCCAACATGGCCTTCCAAGAGATCATTATCCAATACGAA
TRN  10010101100011001
NAM  HCYA_EURCA/380-629
ASQ  PVYSKDNLDFPQVTITDVKVKAKIPNVVHTFIRED-----ELELSHCLHFAKPGSVRARYHHLDHESFSYIISAQNNSNADKQATVRIFLAPTYDELGNDISLDEQRRLYIEMDKFYHTLRPGKNTIVRSSTDSSVTLSSVHTFKELLRGEDLVEG-.--------QTEFCSCGWPQHLLVPKGNEKGMQFDLFVMLTDASVDRVQSGDGTPLCADALSYCGV.LDQKYPDKRAMGYPFDRKITADTHEEFLTGNMNISHVTVRFQ
DSQ  CCAGTGTACAGCAAGGACAATCTGGACTTCCCTCAAGTAACCATAACGGATGTCAAGGTGAAAGCCAAAATTCCCAATGTCGTGCACACTTTCATCAGGGAGGAT---------------GAACTGGAACTTTCCCACTGCTTACACTTCGCCAAGCCTGGATCTGTCCGAGCAAGATACCATCATTTGGATCACGAATCTTTCTCCTACATCATCAGCGCCCAGAACAACAGCAATGCTGACAAGCAGGCAACTGTTCGAATCTTCCTGGCCCCCACATACGATGAACTCGGAAATGACATCTCACTAGACGAACAGAGGAGACTGTACATTGAAATGGACAAATTCTATCACACTTTGCGTCCTGGCAAGAACACTATTGTAAGATCCTCCACTGACTCAAGCGTAACACTGTCATCAGTCCATACTTTCAAGGAACTTCTTCGTGGAGAGGATCTCGTTGAAGGC---...------------------------CAGACCGAATTCTGCAGCTGTGGTTGGCCCCAGCATCTCCTGGTACCTAAAGGCAATGAGAAGGGAATGCAGTTTGACCTCTTCGTCATGCTGACAGATGCCTCTGTTGATAGGGTACAAAGTGGTGATGGCACTCCCCTTTGCGCTGATGCACTCAGCTACTGCGGTGTC...TTGGACCAGAAATACCCAGACAAGAGAGCTATGGGTTATCCATTTGATAGGAAGATTACTGCGGACACTCATGAAGAATTCCTGACAGGAAATATGAACATTTCCCACGTCACAGTCCGCTTCCAA
TRN  10010101100011000
NAM  HCY2_LIMPO/379-627
ASQ  KPYDHDVLNFPDIQVQDVTLHARVDNVVHFTMREQ-----ELELKHGINPGNARSIKARYYHLDHEPFSYAVNVQNNSASDKHATVRIFLAPKYDELGNEIKADELRRTAIELDKFKTDLHPGKNTVVRHSLDSSVTLSHQPTFEDLLHGVGLNEH-.--------KSEYCSCGWPSHLLVPKGNIKGMEYHLFVMLTDWDKDKVD-GSESVACVDAVSYCGA.RDHKYPDKKPMGFPFDRPIHTEHISDFLTNNMFIKDIKIKFH
NAM  HCYC_PANIN/405-655
ASQ  TPYTRDELEFNGVSIDSIAIEGTLETFFENFEYSL-----LNAVDDTVDI-ADVEILTYIERLNHKKFSFLILVTNNNNTEVLATVRIFAWPLRDNNGIEYSFNEGRWRALELDRFWVKVKHGHHQITRQSTESSVTVPDVPSLQTLIDRADAAISS.--GCALHLEDYESALGLPNRFLLPKGQAQGMEFNLVVAVTDGRTDAAL-DDLHENTKFIHYGY--.-DRQYPDKRPHGYPLDRRVDDERIFEALP-NFKQRTVKLYSH
NAM  HCYA_PANIN/399-652
ASQ  PPYTHDNLEFSGMVVNGVAIDGELITFFDEFQYSL-----INAVDSGENI-EDVEINARVHRLNHKEFTYKITMSNNNDGERLATFRIFLCPIEDNNGITLTLDEARWFCIELDKFFQKVPKGPETIERSSKDSSVTVPDMPSFQSLKEQADNAVNG.--GHDLDLSAYERSCGIPDRMLLPKSKPEGMEFNLYVAVTDGDKDTEG-HNGGHDYGGTHAQCGV.HGEAYPDNRPLGYPLERRIPDERVIDGVS-NIKHVVVKIVHH
//