EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03719 - Ribosomal_S5_C)
FAM  PF03719
PID  Ribosomal_S5_C
DES  Ribosomal protein S5, C-terminal domain
IPR  IPR005324
ANO  12
ALN  75
AID  0.358688
APH  (((((((((RS5_BACST/85-158:0.10295,RS5_MYCCA/119-192:0.47655):0.12103,(RS5_ECOLI/84-157:0.37925,RS5_MICLU/82-155:0.24123):0.17951):0.06940,RR5_CYAPA/92-165:0.55615):0.10462,RS5_CHLTR/88-161:0.52636):0.33535,RT05_YEAST/220-293:1.26266):0.39050,RS5_METVA/141-215:0.37595):0.08258,RS5_HALMA/132-205:0.25803):0.52585,RS2_YEAST/157-230:0.19653):0.16514,RS2_CRIGR/124-197:0.19085,RS2_DICDI/171-244:0.14846);
ATP  (((((((((RS5_BACST/85-158,RS5_MYCCA/119-192),(RS5_ECOLI/84-157,RS5_MICLU/82-155)),RR5_CYAPA/92-165),RS5_CHLTR/88-161),RT05_YEAST/220-293),RS5_METVA/141-215),RS5_HALMA/132-205),RS2_YEAST/157-230),RS2_CRIGR/124-197,RS2_DICDI/171-244);
ATL  6.73894
DNO  11
DLN  225
DID  0.442668
DPH  ((((((RS5_CHLTR/88-161:0.29312,RT05_YEAST/220-293:0.71770):0.27485,RS5_MYCCA/119-192:0.30315):0.08876,(RR5_CYAPA/92-165:0.31924,(RS5_ECOLI/84-157:0.07055,RS5_MICLU/82-155:0.50833):0.29873):0.10174):0.35842,(RS5_HALMA/132-205:0.47217,RS5_METVA/141-215:0.32102):0.15357):0.25246,RS2_YEAST/157-230:0.15644):0.16239,RS2_CRIGR/124-197:0.31828,RS2_DICDI/171-244:0.11049);
DTP  ((((((RS5_CHLTR/88-161,RT05_YEAST/220-293),RS5_MYCCA/119-192),(RR5_CYAPA/92-165,(RS5_ECOLI/84-157,RS5_MICLU/82-155))),(RS5_HALMA/132-205,RS5_METVA/141-215)),RS2_YEAST/157-230),RS2_CRIGR/124-197,RS2_DICDI/171-244);
DTL  5.28141
RID  0.34703
RPH  (((((((RS5_CHLTR/88-161:0.59719,RS5_MYCCA/119-192:0.42840):0.04942,(RR5_CYAPA/92-165:0.51745,(RS5_ECOLI/84-157:0.29762,RS5_MICLU/82-155:0.31330):0.18867):0.12434):0.32678,RT05_YEAST/220-293:1.24499):0.39647,RS5_METVA/141-215:0.34020):0.09377,RS5_HALMA/132-205:0.29001):0.50542,RS2_YEAST/157-230:0.19283):0.16657,RS2_CRIGR/124-197:0.18896,RS2_DICDI/171-244:0.15036);
RTP  (((((((RS5_CHLTR/88-161,RS5_MYCCA/119-192),(RR5_CYAPA/92-165,(RS5_ECOLI/84-157,RS5_MICLU/82-155))),RT05_YEAST/220-293),RS5_METVA/141-215),RS5_HALMA/132-205),RS2_YEAST/157-230),RS2_CRIGR/124-197,RS2_DICDI/171-244);
RTL  6.37182
LNK  RR5_CYAPA/92-165:P23402:M30487
LNK  RS2_CRIGR/124-197:P46791:L22552
LNK  RS2_DICDI/171-244:P27685:X56297
LNK  RS2_YEAST/157-230:P25443:M59375
LNK  RS5_BACST/85-158:P02357:
LNK  RS5_CHLTR/88-161:P28543:M80325
LNK  RS5_ECOLI/84-157:P02356:X01563
LNK  RS5_HALMA/132-205:P26815:X58395
LNK  RS5_METVA/141-215:P14036:X16720
LNK  RS5_MICLU/82-155:P33105:X17524
LNK  RS5_MYCCA/119-192:P10128:X06414
LNK  RT05_YEAST/220-293:P33759:L20296
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  RT05_YEAST/220-293
ASQ  IDFRYHGVKLHLRSAKPGFGLRVNHVIFEICECAGIKDLSGKVYK-SRNDMNIAKGTIEAFTKAQKTLDEVALGR
DSQ  ATAGATTTTAGGTATCATGGTGTGAAACTACATTTAAGAAGTGCAAAACCAGGGTTTGGATTACGTGTAAACCATGTAATCTTTGAGATTTGTGAATGTGCAGGTATCAAAGATCTGAGTGGGAAAGTATATAAA---TCCAGAAACGATATGAATATAGCTAAAGGTACCATCGAGGCTTTCACGAAAGCTCAAAAGACATTGGATGAGGTTGCCCTGGGTAGA
TRN  10010101100011010
NAM  RS5_MYCCA/119-192
ASQ  SLGTFGAGKILIKPAKVGTGIIAGGPARSVIELSGISDVYAKSLG-SNNAINMIRATFEGLSSMQTLKRVQELRY
DSQ  AGTTTAGGAACTTTTGGAGCAGGTAAGATTTTAATTAAACCAGCTAAAGTTGGTACTGGTATTATTGCTGGTGGGCCAGCTCGATCAGTTATTGAATTATCAGGAATTTCAGATGTTTATGCTAAATCATTAGGA---AGCAATAATGCAATTAATATGATTAGAGCTACTTTTGAAGGACTAAGTTCAATGCAAACTTTAAAAAGAGTTCAAGAGTTAAGATAT
TRN  10010101110011000
NAM  RS5_MICLU/82-155
ASQ  VQGEDAAGVVLLRPASPGTAVIAGGPVRAVLECAGIHDVLSKSMG-SVNAINIVRGTVEGLKKLKSPQAVAARRG
DSQ  GTGCAGGGTGAGGACGCCGCCGGCGTCGTGCTGCTCCGCCCGGCCTCCCCGGGTACCGCGGTGATCGCCGGCGGTCCGGTGCGCGCCGTGCTCGAGTGCGCCGGCATCCACGACGTGCTCTCCAAGTCCATGGGC---TCCGTGAACGCGATCAACATCGTGCGCGGCACGGTGGAGGGCCTCAAGAAGCTGAAGAGCCCCCAGGCCGTCGCCGCCCGCCGCGGC
TRN  11011111101111111
NAM  RS5_BACST/85-158
ASQ  VIGHFGAGEIILKPASEGTGVIAGGPARAVLELAGISDILSKSIG-SNTPINMVRATFDGLKQLKRAEDVAKLRG
NAM  RS5_ECOLI/84-157
ASQ  VKGVHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVHNVLAKAYG-STNPINVVRATIDGLENMNSPEMVAAKRG
DSQ  GTTAAAGGTGTTCACACGGGTTCTCGCGTATTCATGCAGCCGGCTTCCGAAGGTACCGGTATCATCGCCGGTGGTGCAATGCGCGCCGTTCTGGAAGTCGCTGGGGTTCATAACGTTCTCGCTAAAGCCTATGGT---TCCACCAACCCGATCAACGTGGTTCGTGCAACTATTGATGGCCTGGAAAATATGAATTCTCCAGAAATGGTCGCTGCCAAGCGTGGT
TRN  11011101101011011
NAM  RR5_CYAPA/92-165
ASQ  IDGIGGAARVIMRPSAEGTGVIAGGAVRTVLELAGVRNILAKQLG-SNNPLNNARAAMNALSRLKTFSQFAKDRG
DSQ  ATTGATGGAATTGGCGGGGCAGCACGTGTAATTATGCGACCATCAGCTGAAGGTACTGGAGTAATTGCAGGTGGAGCTGTACGTACAGTTTTAGAATTAGCTGGAGTTCGAAATATTTTAGCTAAACAACTTGGT---TCTAATAATCCGTTGAATAATGCTAGAGCAGCGATGAATGCTCTTTCTCGTTTAAAAACTTTTTCCCAATTTGCAAAAGATCGCGGT
TRN  10010101110011000
NAM  RS5_CHLTR/88-161
ASQ  VLVNHDGAELLLKPAKPGTGIVAGSRIRLILEMAGVKDIVAKSLG-SNNPMNQVKAAFKALLTLSCKDDIMKRRA
DSQ  GTTCTTGTCAATCATGATGGAGCAGAGCTTCTGTTAAAACCTGCTAAGCCAGGAACCGGAATCGTTGCAGGATCTCGTATTCGGTTGATTTTAGAGATGGCCGGGGTAAAGGACATTGTAGCAAAGAGTTTAGGA---TCCAATAATCCTATGAATCAGGTTAAAGCGGCTTTTAAAGCTCTCCTGACACTCTCTTGTAAAGATGATATTATGAAAAGGAGAGCC
TRN  10010101100011010
NAM  RS5_METVA/141-215
ASQ  AKGTCGSVKVELLPAPRGVGLVAGNVAKAVLGLAGVKDAWTTTYGDTRTTYNFAEATFDALNNLNFVRCLPEQKA
DSQ  GCTAAAGGAACATGCGGTAGTGTTAAGGTTGAATTACTCCCTGCACCAAGGGGTGTAGGTTTAGTTGCAGGTAACGTTGCAAAAGCAGTTCTAGGCCTTGCAGGTGTAAAGGATGCATGGACAACAACTTACGGAGACACAAGAACAACCTACAACTTTGCAGAAGCAACATTTGATGCATTAAACAACTTAAACTTCGTAAGATGCCTACCTGAACAAAAAGCA
TRN  10010101110011010
NAM  RS5_HALMA/132-205
ASQ  TEGKAGSVEVELQPAPRGLGLAGGETVRKVLELAGIEDIWTRSSGNTRTTVNFAKATFNALQNTAEAR-VPERTF
DSQ  ACCGAGGGCAAGGCCGGGAGCGTCGAGGTTGAGCTGCAGCCGGCCCCGCGAGGGCTGGGCCTCGCGGGCGGAGAGACCGTCCGCAAGGTGCTCGAACTCGCCGGTATCGAGGATATCTGGACACGCAGTAGCGGGAACACGCGCACGACGGTCAACTTCGCAAAGGCGACGTTCAACGCCCTGCAGAACACGGCCGAGGCGCGT---GTCCCCGAACGAACCTTC
TRN  11011111101111111
NAM  RS2_YEAST/157-230
ASQ  TTGKCGSVTVRLIPAPRGSGIVASPAVKKLLQLAGVEDVYTQSNGKTRTLENTLKAAFVAIGNTYGFL-TPNLWA
DSQ  ACCACTGGTAAGTGTGGTTCCGTCACTGTTAGATTGATCCCAGCCCCAAGAGGTTCTGGTATCGTCGCTTCTCCAGCTGTCAAAAAGTTGTTGCAATTGGCTGGTGTTGAAGATGTCTACACCCAATCTAACGGTAAGACTAGAACTTTGGAAAACACCTTGAAGGCTGCTTTCGTTGCTATTGGTAACACATACGGTTTCTTG---ACTCCAAACTTGTGGGCC
TRN  10110101110011011
NAM  RS2_DICDI/171-244
ASQ  VTGKCGSVAVRLVPAPRGTGIVAARVPKKLLQYAGVDDVYTSSRGKTRTMGNFVMATFFAITKTFAYL-TPDLWR
DSQ  GTCACTGGTAAATGCGGTTCCGTCGCTGTACGTCTCGTTCCAGCCCCAAGAGGTACTGGTATCGTTGCTGCTCGTGTTCCAAAGAAATTACTCCAATATGCTGGTGTTGATGATGTTTACACATCTTCACGTGGTAAGACCAGAACCATGGGTAACTTTGTCATGGCCACTTTCTTCGCCATCACCAAGACCTTTGCTTACTTA---ACCCCAGATCTTTGGAGA
TRN  10010101110011000
NAM  RS2_CRIGR/124-197
ASQ  VTGRCGSVLVRLIPAPRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYL-TPDLWK
DSQ  GTGACAGGCCGCTGTGGCTCTGTGTTGGTGCGTCTCATCCCTGCCCCCAGAGGCACTGGCATCGTCTCTGCTCCTGTGCCTAAGAAGCTACTGATGATGGCTGGTATTGATGACTGCTACACGTCAGCCAGGGGCTGCACTGCCACCCTGGGCAACTTTGCCAAGGCCACCTTTGATGCCATCTCCAAGACCTACAGCTACCTA---ACCCCCGACCTCTGGAAA
TRN  10010101100011001
//