EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03712 - Cu2_monoox_C)
FAM  PF03712
PID  Cu2_monoox_C
DES  Copper type II ascorbate-dependent monooxygenase, C-terminal domain
IPR  IPR000323
ANO  13
ALN  175
AID  0.363324
APH  (((((O01404_DROME/199-356:0.71373,((Q9Y1M5_LYMST/493-647:0.10889,(Q9Y1M4_LYMST/1160-1313:0.16738,(Q9Y1M4_LYMST/829-983:0.12582,Q9Y1M4_LYMST/162-316:0.18272):0.02303):0.06132):0.46952,(AMD1_XENLA/195-348:0.15816,AMD_BOVIN/194-347:0.21097):0.39827):0.18676):0.09905,O44398_CALPA/192-346:0.50827):0.11462,P83388_CAEEL/167-321:0.72016):1.18167,(Q9XTQ6_CAEEL/334-500:0.50110,Q24549_DROME/400-565:0.38053):0.06247):0.30654,DOPO_HUMAN/345-512:0.10353,DOPO_RAT/362-529:0.11917);
ATP  (((((O01404_DROME/199-356,((Q9Y1M5_LYMST/493-647,(Q9Y1M4_LYMST/1160-1313,(Q9Y1M4_LYMST/829-983,Q9Y1M4_LYMST/162-316))),(AMD1_XENLA/195-348,AMD_BOVIN/194-347))),O44398_CALPA/192-346),P83388_CAEEL/167-321),(Q9XTQ6_CAEEL/334-500,Q24549_DROME/400-565)),DOPO_HUMAN/345-512,DOPO_RAT/362-529);
ATL  6.92788
DNO  13
DLN  525
DID  0.45717
DPH  (((((((((Q9Y1M4_LYMST/829-983:0.11934,Q9Y1M4_LYMST/162-316:0.20102):0.07849,Q9Y1M4_LYMST/1160-1313:0.14552):0.08757,Q9Y1M5_LYMST/493-647:0.08386):0.30659,(AMD1_XENLA/195-348:0.15838,AMD_BOVIN/194-347:0.20343):0.27543):0.07524,(P83388_CAEEL/167-321:0.56660,O44398_CALPA/192-346:0.26235):0.16199):0.08410,O01404_DROME/199-356:0.50360):0.59846,Q9XTQ6_CAEEL/334-500:0.41939):0.06838,Q24549_DROME/400-565:0.29058):0.26557,DOPO_HUMAN/345-512:0.11522,DOPO_RAT/362-529:0.12783);
DTP  (((((((((Q9Y1M4_LYMST/829-983,Q9Y1M4_LYMST/162-316),Q9Y1M4_LYMST/1160-1313),Q9Y1M5_LYMST/493-647),(AMD1_XENLA/195-348,AMD_BOVIN/194-347)),(P83388_CAEEL/167-321,O44398_CALPA/192-346)),O01404_DROME/199-356),Q9XTQ6_CAEEL/334-500),Q24549_DROME/400-565),DOPO_HUMAN/345-512,DOPO_RAT/362-529);
DTL  5.23568
RID  0.363324
RPH  (((((O01404_DROME/199-356:0.71373,((Q9Y1M5_LYMST/493-647:0.10889,(Q9Y1M4_LYMST/1160-1313:0.16738,(Q9Y1M4_LYMST/829-983:0.12582,Q9Y1M4_LYMST/162-316:0.18272):0.02303):0.06132):0.46952,(AMD1_XENLA/195-348:0.15816,AMD_BOVIN/194-347:0.21097):0.39827):0.18676):0.09905,O44398_CALPA/192-346:0.50827):0.11462,P83388_CAEEL/167-321:0.72016):1.18167,(Q9XTQ6_CAEEL/334-500:0.50110,Q24549_DROME/400-565:0.38053):0.06247):0.30654,DOPO_HUMAN/345-512:0.10353,DOPO_RAT/362-529:0.11917);
RTP  (((((O01404_DROME/199-356,((Q9Y1M5_LYMST/493-647,(Q9Y1M4_LYMST/1160-1313,(Q9Y1M4_LYMST/829-983,Q9Y1M4_LYMST/162-316))),(AMD1_XENLA/195-348,AMD_BOVIN/194-347))),O44398_CALPA/192-346),P83388_CAEEL/167-321),(Q9XTQ6_CAEEL/334-500,Q24549_DROME/400-565)),DOPO_HUMAN/345-512,DOPO_RAT/362-529);
RTL  6.92788
LNK  AMD1_XENLA/195-348:P08478:M18134
LNK  AMD_BOVIN/194-347:P10731:M18683
LNK  DOPO_HUMAN/345-512:P09172:X13255
LNK  DOPO_RAT/362-529:Q05754:L12407
LNK  O01404_DROME/199-356:O01404:AF006663
LNK  O44398_CALPA/192-346:O44398:AF036337
LNK  P83388_CAEEL/167-321:P83388:U80438
LNK  Q24549_DROME/400-565:Q24549:Z70316
LNK  Q9XTQ6_CAEEL/334-500:Q9XTQ6:Z99942
LNK  Q9Y1M4_LYMST/1160-1313:Q9Y1M4:AF109920
LNK  Q9Y1M4_LYMST/162-316:Q9Y1M4:AF109920
LNK  Q9Y1M4_LYMST/829-983:Q9Y1M4:AF109920
LNK  Q9Y1M5_LYMST/493-647:Q9Y1M5:AF109919
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.....xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...............xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9XTQ6_CAEEL/334-500
ASQ  KYDAGIMELGLIYSDANSVPPNQKAWAMNGYCPSQCTKN-LPEEGINIFASQLHAHLTGRKLFTSQYR.....SGVRIGDVNRDEHYSPHWQHLQQLRPVVKVMPGDTLVTTCVYDTRKRSKVTFGGYRIVDEMCVNYIYYYPASDV--EVCKSAISNSTLRAYFSERHGMDGKR
DSQ  AAATACGACGCAGGAATTATGGAACTTGGTTTAATATACTCCGATGCAAATTCAGTACCACCAAATCAAAAAGCATGGGCCATGAATGGATATTGTCCATCACAATGCACTAAAAAT---CTTCCCGAGGAGGGAATCAACATTTTCGCCAGTCAACTGCACGCTCATCTAACCGGCAGAAAACTGTTCACATCTCAATATCGA...............TCTGGAGTTCGCATTGGAGACGTGAACCGAGATGAACACTACTCCCCTCATTGGCAGCATCTGCAACAGCTTCGACCAGTGGTTAAGGTTATGCCAGGAGACACACTGGTCACCACATGCGTCTACGATACCAGAAAACGATCAAAAGTGACGTTTGGTGGATATCGAATTGTGGATGAGATGTGCGTCAACTATATTTATTACTACCCAGCTTCTGATGTA------GAAGTTTGCAAATCAGCAATTTCTAATAGTACGTTGAGAGCCTACTTCTCAGAACGACATGGTATGGATGGAAAGAGA
TRN  10010101100011000
NAM  Q24549_DROME/400-565
ASQ  SMTA-VMELGLEYTDKMAIPPGQTAFPLSGYCVADCTRAALPATGIIIFGSQLHTHLRGVRVLTRHFR.....GEQELREVNRDDYYSNHFQEMRTLHYKPRVLPGDALVTTCYYNTKD-DKTALGGFSISDEMCVNYIHYYPATKL--EVCKSSVSEETLENYFIYMKRTEHQH
DSQ  AGTATGACGGCC---GTTATGGAACTGGGCCTGGAGTACACCGACAAAATGGCCATTCCGCCTGGCCAAACCGCATTCCCGCTGAGCGGCTATTGTGTGGCGGACTGCACACGAGCCGCTCTGCCGGCGACGGGCATCATCATCTTTGGCTCTCAGCTGCATACGCATCTGCGTGGCGTTCGCGTCCTAACCCGACACTTTCGC...............GGCGAACAGGAGCTGCGCGAGGTGAACCGCGATGACTACTACTCGAATCACTTCCAGGAGATGCGCACCCTGCACTACAAGCCGCGTGTCCTGCCCGGCGACGCTTTGGTAACCACTTGCTACTACAACACCAAGGAT---GACAAGACCGCCCTCGGCGGATTCTCCATCAGCGATGAGATGTGCGTCAACTATATCCACTACTATCCGGCCACCAAACTG------GAGGTCTGCAAGAGTTCCGTTTCCGAGGAGACGCTCGAGAATTACTTTATTTACATGAAGCGCACGGAGCATCAGCAT
TRN  11011101101011011
NAM  DOPO_RAT/362-529
ASQ  PNEAGIMELGLVYTPLMAIPPQETTFVLTGYCTDRCTQMALPKSGIRIFASQLHTHLTGRKVITVLAR.....DGQQREVVNRDNHYSPHFQEIRMLKNAVTVHQGDVLITSCTYNTENRTMATVGGFGILEEMCVNYVHYYPKTEL--ELCKSAVDDGFLQKYFHIVNRFGNEE
DSQ  CCCAATGAGGCAGGCATCATGGAGCTTGGACTGGTGTACACGCCCTTGATGGCCATCCCCCCTCAGGAGACCACCTTTGTTTTGACTGGCTACTGCACAGACAGGTGCACCCAGATGGCACTGCCGAAATCTGGAATCCGCATCTTTGCCTCACAGCTCCACACGCACCTGACCGGCAGGAAGGTGATTACTGTGCTCGCCAGG...............GATGGCCAACAGAGGGAAGTGGTGAACAGAGACAACCACTACAGCCCCCACTTTCAGGAGATCAGAATGCTGAAGAATGCTGTGACTGTCCACCAGGGGGATGTCCTCATCACTTCGTGCACATACAACACAGAAAACAGGACAATGGCCACAGTGGGGGGGTTTGGAATCTTGGAGGAGATGTGCGTCAACTACGTCCACTACTACCCCAAAACAGAGCTG------GAGCTCTGCAAGAGTGCCGTGGATGATGGCTTCCTGCAGAAATACTTCCACATAGTAAACCGGTTCGGCAATGAGGAG
TRN  10010101100011001
NAM  DOPO_HUMAN/345-512
ASQ  RFNAGIMELGLVYTPVMAIPPRETAFILTGYCTDKCTQLALPPSGIHIFASQLHTHLTGRKVVTVLVR.....DGREWEIVNQDNHYSPHFQEIRMLKKVVSVHPGDVLITSCTYNTEDRELATVGGFGILEEMCVNYVHYYPQTQL--ELCKTAVDAGFLQKYFHLINRFNNED
DSQ  CGCTTCAACGCGGGGATCATGGAGCTGGGACTGGTGTACACGCCAGTGATGGCCATTCCACCACGGGAGACCGCCTTCATCCTCACTGGCTACTGCACGGACAAGTGCACCCAGCTGGCACTGCCTCCCTCCGGGATCCACATCTTCGCCTCTCAGCTCCACACACACCTGACTGGGAGAAAGGTGGTCACAGTGCTGGTCCGG...............GACGGCCGGGAGTGGGAGATCGTGAACCAGGACAATCACTACAGCCCTCACTTCCAGGAGATCCGCATGTTGAAGAAGGTCGTGTCGGTCCATCCGGGAGATGTGCTCATCACCTCCTGCACGTACAACACGGAAGACCGGGAGCTGGCCACAGTGGGGGGCTTCGGGATCCTGGAGGAGATGTGTGTCAACTACGTGCACTACTACCCCCAGACGCAGCTG------GAGCTCTGCAAGACGGCTGTGGACGCCGGCTTCCTGCAGAAGTACTTCCACCTCATCAACAGGTTCAACAACGAGGAT
TRN  10010101100011011
NAM  O01404_DROME/199-356
ASQ  KKLAG----TLLLGTDGQIPAMKT-EHLETACEVNEQKV------LHPFAYRVHTHGLGKVVSGYRVRtnsdgEQEWLQLGKRDPLTP---QMFYNTSNTDPIIEGDKIAVRCTMQSTR-HRTTKIGPTNEDEMCNFYLMYYVDHGE--TLNMKFCFSQGAPYYFWSNPDSGLHN
DSQ  AAAAAGCTGGCTGGC------------ACTCTGCTGCTGGGCACTGACGGACAGATTCCGGCGATGAAGACG---GAGCACCTGGAAACCGCCTGCGAGGTGAACGAGCAGAAGGTG------------------CTGCATCCTTTTGCGTACCGGGTGCACACCCACGGCCTGGGAAAGGTCGTTTCCGGCTACCGGGTGAGGacaaacagcgacggcGAACAGGAGTGGCTGCAGCTGGGCAAGAGAGATCCCCTCACGCCC---------CAGATGTTCTATAACACCAGCAACACAGACCCCATAATCGAGGGAGATAAGATCGCCGTGAGGTGTACTATGCAGAGCACTCGC---CATCGGACTACCAAAATAGGTCCCACGAACGAGGACGAGATGTGCAACTTCTATCTCATGTACTATGTGGATCACGGGGAG------ACACTAAACATGAAGTTCTGCTTCAGCCAGGGCGCCCCCTACTACTTCTGGTCCAATCCCGACTCCGGCCTACACAAT
TRN  10010101100011011
NAM  O44398_CALPA/192-346
ASQ  HHLA--AILVLTNRERAAIPPQKEAFNLDMGCQYTGKTI------IHPFAFRVHAHSLGSVTTGYRIR.....NKKWELIGKGDPQRP---QAFYAIDKNMDIRSGDILAGQCTYNTMKKQKTTYIGATMKDEMCNFYMMYYYDS----STPGSAAPGDYCREHFVSPADSIVLL
DSQ  CATCACTTGGCT------GCAATTTTAGTTCTAACAAACAGAGAGCGGGCTGCAATTCCACCACAGAAAGAAGCTTTTAATCTTGATATGGGCTGCCAATATACAGGCAAGACTATA------------------ATTCATCCTTTTGCCTTCAGAGTCCATGCCCACTCGCTTGGCAGTGTTACAACTGGTTACAGGATACGG...............AATAAAAAATGGGAATTGATTGGCAAAGGAGATCCACAAAGACCA---------CAGGCTTTTTATGCTATTGACAAGAACATGGACATTAGAAGTGGAGATATATTGGCTGGGCAGTGTACCTACAACACTATGAAGAAGCAGAAAACTACTTATATAGGAGCGACAATGAAAGATGAGATGTGTAATTTCTATATGATGTATTACTATGATTCT------------TCAACTCCTGGTTCAGCTGCTCCAGGGGATTATTGCAGGGAGCATTTCGTCAGCCCTGCAGACTCAATTGTACTCCTC
TRN  10010101110011000
NAM  AMD_BOVIN/194-347
ASQ  PLIA---GMYLMMSVDTVIPPGGKVVNSDISCHYK-KYP------MHVFAYRVHTHHLGKVVSGYRVR.....NGQWTLIGRQSPQLP---QAFYPVEHPVDVSFGDILAARCVFTGEGRTEVTHIGGTSSDEMCNLYIMYYMEAKH--AVSFMTCTQNVAPDIF-RTIPPEANI
DSQ  CCTTTAATTGCT---------GGCATGTACCTTATGATGTCTGTTGACACTGTTATACCACCAGGAGGGAAAGTGGTGAATTCTGATATTTCATGCCATTATAAA---AAGTATCCA------------------ATGCATGTCTTTGCCTACAGAGTTCACACTCACCATTTAGGCAAGGTAGTCAGTGGATACAGAGTAAGA...............AATGGACAGTGGACCCTGATTGGACGCCAAAGCCCCCAACTGCCA---------CAGGCCTTCTACCCAGTAGAGCACCCAGTGGATGTGAGTTTTGGTGACATCCTGGCAGCAAGATGTGTGTTCACTGGGGAAGGGAGGACAGAAGTCACACACATTGGTGGCACGTCTAGTGATGAAATGTGCAACTTATACATTATGTATTACATGGAAGCCAAGCAT------GCAGTTTCTTTCATGACCTGTACACAGAATGTAGCTCCAGATATATTC---AGAACCATACCACCAGAGGCCAATATT
TRN  10010101100011000
NAM  AMD1_XENLA/195-348
ASQ  PQIA---GIYLSMSVDTVIPPGEEAVNSDIACLYN-RPT------IHPFAYRVHTHQLGQVVSGFRVR.....HGKWSLIGRQSPQLP---QAFYPVEHPVEISPGDIIATRCLFTGKGRTSATYIGGTSNDEMCNLYIMYYMDAAH--ATSYMTCVQTGEPKLF-QNIPEIANV
DSQ  CCGCAAATTGCA---------GGCATTTATCTTTCAATGTCTGTGGACACTGTTATTCCACCTGGGGAAGAGGCAGTTAATTCTGATATCGCCTGCCTCTACAAC---AGGCCGACA------------------ATACACCCATTTGCCTACAGAGTCCACACTCATCAGTTGGGGCAGGTCGTAAGTGGATTTAGAGTGAGA...............CATGGCAAGTGGTCTTTAATTGGTAGACAAAGCCCACAGCTGCCA---------CAGGCATTTTACCCTGTAGAGCATCCAGTAGAGATTAGCCCTGGGGATATTATAGCAACCAGGTGTCTGTTCACTGGTAAAGGCAGGACGTCAGCAACATATATTGGTGGCACATCTAACGATGAAATGTGTAATTTATACATCATGTATTACATGGATGCGGCCCAT------GCTACGTCATACATGACCTGTGTACAGACGGGTGAACCAAAGTTATTT---CAAAACATCCCTGAGATTGCAAATGTT
TRN  10010101100011000
NAM  Q9Y1M4_LYMST/1160-1313
ASQ  PFVA---GVYFMAS-MFEIPSGFPAYPVDVSCMFDKQKS------IFPFAYRTHAHALGRVITGYQY-.....NGSYHEIGKGNPQWP---QAFYPVKDKIEVKPGEYLAARCTYDSTSMTSSVKVGSTGNDEMCNFYIMFYTDSSV--LDPYGKCLGNLAPELTGDNFPKDVSV
DSQ  CCTTTTGTTGCT---------GGTGTCTATTTCATGGCTTCA---ATGTTTGAAATTCCCAGTGGATTTCCTGCATATCCTGTTGATGTCAGCTGTATGTTTGACAAGCAGAAAAGT------------------ATTTTTCCTTTTGCTTACAGGACCCACGCCCATGCCTTAGGTCGTGTCATCACTGGCTACCAGTAC---...............AATGGTTCCTATCATGAGATTGGCAAGGGAAATCCTCAGTGGCCA---------CAGGCATTTTACCCTGTCAAAGACAAGATTGAGGTCAAGCCTGGGGAATATCTTGCTGCCAGATGTACTTATGATTCAACATCCATGACCAGCTCTGTTAAAGTGGGATCTACTGGTAATGATGAGATGTGCAACTTTTACATCATGTTCTACACGGACAGCTCTGTA------CTAGATCCTTATGGAAAGTGCTTGGGTAACTTGGCCCCCGAACTGACTGGTGACAATTTCCCCAAAGATGTAAGTGTG
TRN  10010101100011000
NAM  Q9Y1M4_LYMST/829-983
ASQ  KFVA---GIYFLMSPMFNIPPGETSYPIDVSCKFGAEKS------IVPFAYRTHAHGLGRVITGYQH-.....NGSYHEIGKGNPQWP---QAFYPVKDLIEVKPGDALAARCTYDSTTMAHAVSVGSTGNDEMCNFYIMFYTDSSV--INPYGQCAGNHLPDVTGRNFPPDVSV
DSQ  AAGTTTGTTGCT---------GGCATTTACTTCCTGATGTCACCCATGTTTAACATTCCACCCGGAGAAACATCCTATCCCATTGATGTCAGTTGTAAATTTGGTGCTGAAAAGAGT------------------ATTGTCCCCTTTGCTTACAGGACACATGCACATGGCTTAGGTCGTGTGATCACAGGCTACCAGCAT---...............AATGGATCCTATCATGAGATTGGCAAAGGCAACCCTCAATGGCCA---------CAGGCATTTTACCCTGTCAAAGATCTGATTGAGGTCAAACCAGGAGATGCACTTGCTGCTAGATGCACCTATGATTCCACGACAATGGCACATGCAGTCAGCGTTGGGTCCACTGGCAATGATGAGATGTGCAATTTCTACATCATGTTCTACACTGACAGCTCAGTG------ATCAATCCCTATGGTCAGTGTGCAGGTAACCATCTGCCAGATGTGACCGGCAGGAATTTCCCTCCTGATGTCAGTGTC
TRN  10010101100011000
NAM  Q9Y1M5_LYMST/493-647
ASQ  KFVA---GIFLLMSTSFSIPEGNSSYPVDISCKFDQEKS------IFPFAYRTHAHGLGRVITGYQK-.....NETYHQIGKGNPQWP---QAFYPVKDVIEVKPGDYLAARCTYDSTSMSHPVSVGATGNDEMCNFYIMFYTDSSV--LEPYGDCSYDEYPDLTGQNFPKDVSM
DSQ  AAATTTGTTGCT---------GGCATCTTTCTTCTAATGTCAACCAGCTTTTCCATACCTGAGGGGAATTCTTCATATCCAGTTGACATTAGTTGTAAATTTGACCAGGAAAAGAGC------------------ATTTTTCCATTTGCTTACAGAACCCATGCTCACGGACTTGGTCGTGTGATTACCGGCTACCAAAAG---...............AATGAAACGTACCATCAGATTGGCAAGGGAAATCCTCAGTGGCCA---------CAGGCATTTTACCCTGTCAAGGATGTCATTGAGGTCAAGCCTGGAGATTATCTGGCTGCCAGATGTACTTACGACTCTACATCAATGTCCCATCCTGTCAGTGTGGGAGCCACTGGCAACGATGAGATGTGCAACTTCTACATCATGTTTTACACAGACAGCTCTGTT------CTTGAGCCTTATGGGGACTGCTCATATGATGAATACCCAGATTTGACCGGCCAAAATTTTCCCAAAGATGTTAGCATG
TRN  10010101100011001
NAM  Q9Y1M4_LYMST/162-316
ASQ  QYVA---GIYILMAGYFSIPSGKKSYPVDVSCSFNEEKS------IFPFAYRTHAHGLGRVITGYQF-.....NGSHHEIGKGNPQWP---QAFYSTQNKIEVKKGDKLAARCTYDSTSMTHPVSVGSTGSDEMCNFYIMFYTDSSV--VNPYGQCVGDFEPLVTGQNFPKDVSD
DSQ  CAATATGTAGCA---------GGAATATACATTTTGATGGCAGGGTATTTTTCTATTCCAAGTGGTAAAAAATCCTATCCTGTTGATGTAAGCTGTTCATTTAATGAGGAGAAAAGT------------------ATTTTTCCTTTTGCATACAGAACACATGCACATGGACTAGGTCGAGTGATCACTGGCTATCAGTTC---...............AATGGATCTCATCACGAAATAGGAAAAGGCAATCCACAATGGCCG---------CAGGCTTTTTATTCCACACAAAATAAGATAGAGGTGAAAAAAGGTGACAAACTGGCTGCTCGATGCACTTATGACTCCACTTCTATGACACATCCAGTCAGTGTAGGGTCCACAGGCAGTGATGAGATGTGCAACTTTTATATCATGTTCTACACAGACAGCTCAGTG------GTCAATCCTTATGGGCAGTGTGTAGGGGATTTTGAGCCTTTAGTGACTGGTCAGAACTTCCCAAAAGATGTCAGTGAC
TRN  10010101100011000
NAM  P83388_CAEEL/167-321
ASQ  MNLA---A-VMLFVSGTPIPPQLPAFQNNITCMFESSTP------IHPFAFRTHTHAMGRLVSAFFKH.....DGHWTKIGKRNPQWP---QLFEGIPSKLMIGSGDQMSASCRFDSMDKNRTVNMGAMGVDEMCNFYMMFHYDAKLDNPYPQGAICAKDYPSKMIDYPKDGF--
DSQ  ATGAACTTGGCG---------GCG---GTTATGCTATTCGTTAGTGGTACTCCAATTCCACCACAACTTCCAGCTTTCCAGAACAACATAACCTGTATGTTCGAGTCTTCAACTCCA------------------ATTCATCCATTTGCATTCCGTACCCATACTCATGCAATGGGACGTCTTGTCTCCGCATTTTTCAAACAT...............GACGGACATTGGACAAAAATTGGAAAAAGAAATCCTCAATGGCCA---------CAACTTTTTGAAGGAATTCCATCAAAATTGATGATTGGAAGTGGAGATCAAATGTCGGCATCTTGCAGATTTGATAGTATGGATAAAAATCGAACCGTCAATATGGGAGCAATGGGAGTTGATGAAATGTGCAATTTCTATATGATGTTCCATTATGATGCGAAACTTGATAATCCATATCCACAAGGAGCAATCTGTGCTAAAGATTATCCTTCAAAGATGATTGATTATCCAAAAGATGGTTTC------
TRN  10010101110011001
//