EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03711 - OKR_DC_1_C)
FAM  PF03711
PID  OKR_DC_1_C
DES  Orn/Lys/Arg decarboxylase, C-terminal domain
IPR  IPR008286
ANO  9
ALN  138
AID  0.397875
APH  ((DCOR_LACS3/576-709:0.42076,((YAAO_BACSU/385-478:1.18063,ADIA_ECOLI/615-748:0.66824):0.25247,(DCLZ_ECOLI/570-704:0.16518,(DCLY_ECOLI/570-704:0.11439,Q9Z4R7_EIKCO/568-702:0.17010):0.19192):0.38467):0.63176):0.11608,(DCOR_ECOLI/568-701:0.20711,DCOS_ECOLI/576-709:0.15029):0.22900,DCOR_HAEIN/575-708:0.14599);
ATP  ((DCOR_LACS3/576-709,((YAAO_BACSU/385-478,ADIA_ECOLI/615-748),(DCLZ_ECOLI/570-704,(DCLY_ECOLI/570-704,Q9Z4R7_EIKCO/568-702)))),(DCOR_ECOLI/568-701,DCOS_ECOLI/576-709),DCOR_HAEIN/575-708);
ATL  5.02859
DNO  8
DLN  414
DID  0.477293
DPH  (DCLY_ECOLI/570-704:0.15012,(DCLZ_ECOLI/570-704:0.24456,(ADIA_ECOLI/615-748:0.45968,(YAAO_BACSU/385-478:0.73135,((DCOR_LACS3/576-709:0.41801,DCOR_HAEIN/575-708:0.19846):0.10486,DCOS_ECOLI/576-709:0.20270):0.37475):0.06184):0.21658):0.10452,Q9Z4R7_EIKCO/568-702:0.19922);
DTP  (DCLY_ECOLI/570-704,(DCLZ_ECOLI/570-704,(ADIA_ECOLI/615-748,(YAAO_BACSU/385-478,((DCOR_LACS3/576-709,DCOR_HAEIN/575-708),DCOS_ECOLI/576-709)))),Q9Z4R7_EIKCO/568-702);
DTL  3.47118
RID  0.388322
RPH  (Q9Z4R7_EIKCO/568-702:0.17086,DCLY_ECOLI/570-704:0.11454,(((ADIA_ECOLI/615-748:0.66987,YAAO_BACSU/385-478:1.18350):0.23671,(DCOR_LACS3/576-709:0.42159,(DCOR_HAEIN/575-708:0.19700,DCOS_ECOLI/576-709:0.33175):0.07297):0.63556):0.40473,DCLZ_ECOLI/570-704:0.17692):0.18130);
RTP  (Q9Z4R7_EIKCO/568-702,DCLY_ECOLI/570-704,(((ADIA_ECOLI/615-748,YAAO_BACSU/385-478),(DCOR_LACS3/576-709,(DCOR_HAEIN/575-708,DCOS_ECOLI/576-709))),DCLZ_ECOLI/570-704));
RTL  4.7973
LNK  ADIA_ECOLI/615-748:P28629:M93362
LNK  DCLY_ECOLI/570-704:P23892:M76411
LNK  DCLZ_ECOLI/570-704:P52095:D87518
LNK  DCOR_ECOLI/568-701:P21169:
LNK  DCOR_HAEIN/575-708:P44317:U32740
LNK  DCOR_LACS3/576-709:P43099:U11816
LNK  DCOS_ECOLI/576-709:P24169:M64495
LNK  Q9Z4R7_EIKCO/568-702:Q9Z4R7:U89166
LNK  YAAO_BACSU/385-478:P37536:D26185
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9Z4R7_EIKCO/568-702
ASQ  LPRVFNESPSFYQEMRIQELAQGIHSLICKHNLPELMFSAF--EVLP-TMVMNPHKAFQLELKGQIEDCYLEDMVGKINANMILPYPPGVPLVMPGEMITEESKPILEFLMMLCEIGAHFPGFETDIHGAYRQEDGRY
DSQ  TTGCCGCGCGTATTCAACGAATCGCCCTCTTTCTACCAAGAAATGCGGATTCAAGAATTGGCACAAGGCATCCACAGCCTGATCTGCAAACACAACCTGCCTGAACTGATGTTCAGCGCATTC------GAAGTGTTGCCG---ACCATGGTGATGAACCCGCACAAAGCCTTCCAGCTTGAGCTGAAAGGTCAGATTGAAGACTGCTACTTGGAAGACATGGTAGGCAAGATCAACGCCAACATGATTCTGCCCTATCCTCCCGGCGTACCGTTGGTAATGCCTGGTGAAATGATCACCGAAGAAAGCAAGCCCATCTTGGAATTCCTGATGATGCTGTGCGAAATCGGCGCCCACTTCCCCGGCTTCGAAACCGACATCCACGGTGCTTACCGTCAAGAAGACGGCCGCTAT
TRN  11011101101011011
NAM  DCLY_ECOLI/570-704
ASQ  LPSLYREDPEFYENMRIQELAQNIHKLIVHHNLPDLMYRAF--EVLP-TMVMTPYAAFQKELHGMTEEVYLDEMVGRINANMILPYPPGVPLVMPGEMITEESRPVLEFLQMLCEIGAHYPGFETDIHGAYRQADGRY
DSQ  CTGCCGTCTCTGTATCGTGAAGATCCTGAATTCTATGAAAACATGCGTATTCAGGAACTGGCTCAGAATATCCACAAACTGATTGTTCACCACAATCTGCCGGATCTGATGTATCGCGCATTT------GAAGTGCTGCCG---ACGATGGTAATGACTCCGTATGCTGCATTCCAGAAAGAGCTGCACGGTATGACCGAAGAAGTTTACCTCGACGAAATGGTAGGTCGTATTAACGCCAATATGATCCTTCCGTACCCGCCGGGAGTTCCTCTGGTAATGCCGGGTGAAATGATCACCGAAGAAAGCCGTCCGGTTCTGGAGTTCCTGCAGATGCTGTGTGAAATCGGCGCTCACTATCCGGGCTTTGAAACCGATATTCACGGTGCATACCGTCAGGCTGATGGCCGCTAT
TRN  11011101101011011
NAM  DCLZ_ECOLI/570-704
ASQ  LPDLYAEDPDFYRNMRIQDLAQGIHKLIRKHDLPGLMLRAF--DTLP-EMIMTPHQAWQRQIKGEVETIALEQLVGRVSANMILPYPPGVPLLMPGEMLTKESRTVLDFLLMLCSVGQHYPGFETDIHGAKQDEDGVY
DSQ  CTACCCGATCTCTATGCAGAAGATCCCGATTTCTACCGCAATATGCGTATTCAGGATCTGGCACAAGGGATCCATAAGCTGATTCGTAAACACGATCTTCCCGGTTTGATGTTGCGGGCATTC------GATACTTTGCCG---GAGATGATCATGACGCCACATCAGGCATGGCAACGACAAATTAAAGGCGAAGTAGAAACCATTGCGCTGGAACAACTGGTCGGTAGAGTATCGGCAAATATGATCCTGCCTTATCCACCGGGCGTACCGCTGTTGATGCCTGGAGAAATGCTGACCAAAGAGAGCCGCACAGTACTCGATTTTCTACTGATGCTTTGTTCCGTCGGGCAACATTACCCCGGTTTTGAAACGGATATTCACGGCGCGAAACAGGACGAAGACGGCGTTTAC
TRN  10010101100011011
NAM  DCOS_ECOLI/576-709
ASQ  LPSIYKQHEERYAGYTLRQLCQEMHDLYARHNVKQLQKEMFRKEHFP-RVSMNPQEANYAYLRGEVELVRLPDAEGRIAAEGALPYPPGVLCVVPGEIW---GGAVLRYFSALEEGINLLPGFAPELQGVYIEEHDGR
DSQ  CTACCTTCCATCTACAAACAGCATGAAGAGCGCTACGCCGGTTATACCCTGCGTCAGTTGTGTCAGGAAATGCATGATTTGTATGCCCGCCACAACGTGAAACAACTGCAAAAAGAGATGTTCCGTAAGGAGCACTTCCCA---CGCGTCAGCATGAATCCGCAAGAAGCCAACTACGCCTATTTACGCGGTGAAGTGGAACTGGTTCGTCTGCCGGATGCAGAAGGCCGTATCGCTGCCGAAGGTGCGCTTCCTTATCCTCCGGGTGTGCTGTGTGTTGTTCCGGGTGAAATCTGG---------GGTGGTGCTGTTCTGCGTTACTTCAGCGCTCTGGAAGAAGGGATCAACCTGCTGCCAGGTTTTGCACCGGAGCTGCAGGGTGTCTATATCGAAGAACATGATGGTCGT
TRN  11011101101011010
NAM  DCOR_ECOLI/568-701
ASQ  LPSVYNKYPVRYRDYTLRQLCQEMHDLYVSFDVKDLQKAMFRQQSFP-SVVMNPQDAHSAYIRGDVELVRIRDAEGRIAAEGALPYPPGVLCVVPGEVW---GGAVQRYFLALEEGVNLLPGFSPELQGVYSETDADG
NAM  DCOR_HAEIN/575-708
ASQ  LPTVYKNNEDRYKGYTIRQLCQEMHDLYVSRNVKQLQKDLFRKATLP-EYVLNPHDANIELIRNKVELVPLTDIVGRVAAEGALPYPPGVLCVVPGEKW---STTAHQYFLALEEGINTLPGFAPEIQGVYLQKDPDG
DSQ  TTACCAACTGTGTATAAAAACAATGAAGATCGTTACAAAGGTTACACCATTCGTCAATTATGCCAAGAAATGCATGATCTTTATGTAAGCCGAAATGTAAAACAACTTCAAAAAGATTTGTTCCGCAAAGCGACATTACCA---GAATATGTATTAAATCCACATGATGCAAATATTGAGTTAATACGTAACAAAGTTGAACTCGTTCCGTTGACTGATATTGTTGGTCGTGTGGCTGCGGAAGGTGCGTTACCTTACCCTCCAGGTGTGTTATGTGTAGTGCCAGGAGAAAAATGG---------AGCACTACAGCACACCAATATTTCCTTGCGTTAGAAGAAGGGATCAACACATTACCTGGTTTCGCACCTGAAATCCAAGGGGTTTACTTACAAAAAGACCCTGATGGA
TRN  10010101110011010
NAM  DCOR_LACS3/576-709
ASQ  LPSIYAANEERYNGYTIRELCQELHDFYKNNNTFTYQKRLFLREFFP-EQGMLPYEARQEFIRNHNKLVPLNKIEGEIALEGALPYPPGVFCVAPGEKW---SETAVKYFTILQDGINNFPGFAPEIQGVYFKQEGDK
DSQ  CTTCCTTCAATCTACGCTGCTAACGAAGAACGTTACAATGGCTACACTATCCGTGAACTTTGCCAAGAATTGCACGACTTCTACAAGAACAACAACACGTTCACATACCAGAAGCGTCTCTTCTTACGTGAATTCTTCCCA---GAACAAGGTATGCTTCCATACGAAGCTCGTCAAGAATTCATCCGCAACCACAACAAGCTTGTTCCATTGAACAAGATCGAAGGCGAAATCGCCCTCGAAGGTGCTCTTCCATACCCTCCAGGAGTATTCTGTGTAGCACCAGGTGAAAAGTGG---------TCAGAAACTGCTGTTAAGTACTTCACTATCTTACAAGATGGTATCAACAACTTCCCTGGATTCGCTCCAGAAATCCAAGGTGTATACTTCAAGCAAGAAGGCGACAAG
TRN  11011111111111100
NAM  YAAO_BACSU/385-478
ASQ  VSAEWGVQPV---------------------------------TVLPY-----PKKVLHSF---KKEYVSFEEAAGRLNAEDIIPYPPGIPMIMAGERITKESVQKLSRLISMK---THVQGNMKIKEKQLLVYIEEE
DSQ  GTTTCTGCAGAATGGGGTGTGCAGCCTGTT---------------------------------------------------------------------------------------------------ACTGTCTTGCCTTAT---------------CCAAAAAAGGTCTTACATTCGTTT---------AAGAAAGAATATGTGAGCTTTGAGGAAGCAGCTGGCCGGCTTAATGCAGAAGATATCATCCCTTATCCTCCGGGTATCCCGATGATTATGGCGGGAGAAAGAATAACAAAAGAAAGTGTGCAAAAGCTCAGCCGCTTGATCAGCATGAAA---------ACGCATGTTCAAGGGAATATGAAAATCAAAGAGAAACAACTACTTGTTTATATAGAAGAGGAG
TRN  10010101110011010
NAM  ADIA_ECOLI/615-748
ASQ  MPELVEQYPDTYANMGIHDLGDTMFAWLKENNPGARLNEAY--SGLP-VAEVTPREAYNAIVDNNVELVSIENLPGRIAANSVIPYPPGIPMLLSGENFGDKNSPQVSYLRSLQSWDHHFPGFEHETEGTEI-IDGIY
DSQ  ATGCCGGAACTTGTTGAACAATATCCTGACACTTACGCGAACATGGGGATTCACGATCTGGGTGACACCATGTTTGCCTGGCTGAAAGAAAACAACCCTGGCGCACGGTTGAACGAAGCCTAT------TCCGGCCTGCCG---GTGGCGGAAGTCACCCCGCGTGAAGCGTACAACGCGATTGTCGACAACAATGTCGAACTGGTATCCATTGAAAATCTGCCAGGACGCATCGCGGCAAACTCAGTTATCCCGTATCCGCCAGGAATCCCGATGCTGCTGTCTGGTGAAAACTTCGGCGATAAAAACAGTCCGCAAGTAAGTTATTTACGCTCGCTGCAATCCTGGGACCACCATTTCCCTGGATTTGAACACGAAACTGAAGGGACTGAAATT---ATTGACGGTATTTAC
TRN  11011101101011000
//