EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03708 - Avian_gp85)
FAM  PF03708
PID  Avian_gp85
DES  Avian retrovirus envelope protein, gp85
IPR  IPR005166
ANO  4
ALN  262
AID  0.575839
APH  (O92955_9RETR/156-409:0.16147,(ENV_RSVP/160-406:0.02513,O73908_CHICK/16-248:1.35719):0.05785,ENV_RSVSA/157-402:0.17523);
ATP  (O92955_9RETR/156-409,(ENV_RSVP/160-406,O73908_CHICK/16-248),ENV_RSVSA/157-402);
ATL  1.77687
DNO  3
DLN  786
DID  0.543176
DPH  (ENV_RSVSA/157-402:0.17242,O92955_9RETR/156-409:0.06594,O73908_CHICK/16-248:1.11294);
DTP  (ENV_RSVSA/157-402,O92955_9RETR/156-409,O73908_CHICK/16-248);
DTL  1.3513
RID  0.489842
RPH  (ENV_RSVSA/157-402:0.18279,O92955_9RETR/156-409:0.12962,O73908_CHICK/16-248:1.37557);
RTP  (ENV_RSVSA/157-402,O92955_9RETR/156-409,O73908_CHICK/16-248);
RTL  1.68798
LNK  ENV_RSVP/160-406:P03396:
LNK  ENV_RSVSA/157-402:P03397:M37980
LNK  O73908_CHICK/16-248:O73908:AJ222690
LNK  O92955_9RETR/156-409:O92955:AF052428
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  ENV_RSVSA/157-402
ASQ  LNVSM-WDEPHELQLLGSQSLPNITNIAQISGITGGCVGFRPQ--GVPWYLG-WSRQEATRFLLRHP-------SFSKSTEPFTVVTADRHNLFMGSEYCGAYGY-RFWNMYNCSQVG-RQYRCGNARSPrPGLPEIQCTRRGGKWVNQSQEINESEPFSFTVNCTASSLGNASG-CCGKAGTILP-GKWVDSTQGSFTKPKALPPAIFLICGDRAWQGIPSRPVGGPCYLGKLTMLAPKHTDILKVLVNSSRTGIRR-KRS
DSQ  CTGAATGTCTCTATG---TGGGATGAGCCACATGAACTACAGCTGTTAGGTTCCCAGTCTCTCCCTAACATTACTAATATTGCTCAGATTTCCGGTATAACCGGGGGATGCGTAGGTTTCAGACCACAA------GGGGTTCCTTGGTATCTAGGT---TGGTCTAGACAGGAGGCCACGCGGTTTCTCCTTAGACACCCC---------------------TCTTTCTCTAAATCCACGGAACCGTTTACGGTGGTGACAGCGGATAGGCACAATCTTTTTATGGGGAGTGAGTACTGCGGTGCATATGGCTAC---AGATTTTGGAACATGTATAACTGCTCACAGGTGGGG---CGGCAGTACCGCTGTGGTAATGCGCGCAGCCCCcgcCCGGGTCTTCCTGAAATCCAGTGTACAAGGAGAGGAGGCAAATGGGTTAATCAATCACAGGAAATTAATGAGTCGGAGCCGTTCAGCTTTACGGTGAACTGTACAGCTAGTAGTTTGGGTAATGCCAGTGGG---TGTTGCGGAAAAGCAGGCACGATTCTCCCG---GGAAAGTGGGTCGACAGCACACAAGGTAGTTTCACCAAACCAAAAGCGCTACCACCCGCAATTTTCCTCATTTGTGGGGATCGCGCATGGCAAGGAATTCCCAGTCGTCCGGTAGGGGGCCCCTGCTATTTAGGCAAGCTTACCATGTTAGCACCTAAGCATACAGATATTCTCAAGGTGCTTGTCAATTCATCGCGGACAGGTATAAGACGT---AAACGAAGC
TRN  10010101100011000
NAM  O92955_9RETR/156-409
ASQ  LNVSL-LDEPSELQLLGSQSLPNITNITRIPSVAGGCIGFTPYDSPAGVY-G-WDRREVTHILLTDPGNNPFFDKASNSSKPFTVVTADRHNLFMGSEYCGAYGY-RFWEMYNCSQMRQNWSICQDVW-G.RGPPENWCTSTGGTWVNQSKEFNETEPFSFTVNCTGSNLGNVSG-CCGEPITILPPEAWVDSTQGSFTKPKALPPAIFLICGDRAWQGIPSRPVGGPCYLGKLTMLAPNHTDILKILANSSRTGIRR-KRS
DSQ  CTGAATGTTTCTCTG---TTGGACGAGCCATCAGAACTACAACTGCTAGGTTCCCAGTCTCTCCCCAATATAACTAATATTACTCGGATCCCCAGTGTGGCTGGGGGATGCATAGGCTTTACCCCATACGATAGTCCGGCTGGTGTCTAC---GGA---TGGGACCGGAGAGAGGTTACACACATCCTTCTGACCGACCCAGGGAACAATCCTTTCTTTGATAAGGCCTCTAACTCCTCGAAACCGTTTACAGTAGTGACAGCGGACAGGCACAATCTCTTTATGGGGAGTGAGTACTGTGGTGCATATGGCTAC---AGGTTCTGGGAAATGTACAATTGCTCCCAAATGAGACAGAATTGGTCCATCTGTCAGGATGTGTGG---GGC...CGAGGCCCCCCCGAAAATTGGTGCACAAGCACAGGAGGTACATGGGTTAATCAATCAAAGGAATTTAATGAGACAGAGCCATTCAGTTTTACTGTGAACTGTACTGGCAGTAATTTGGGTAATGTCAGCGGA---TGTTGCGGAGAACCAATCACGATTCTCCCACCAGAGGCGTGGGTCGACAGCACACAAGGTAGTTTCACTAAACCAAAAGCGCTACCACCCGCAATTTTCCTCATTTGTGGAGATCGCGCATGGCAAGGAATTCCCAGTCGTCCGGTAGGGGGCCCCTGCTATTTAGGCAAGCTCACCATGTTAGCACCCAACCATACAGATATTCTCAAAATTCTTGCTAATTCATCGCGGACAGGAATAAGACGT---AAACGAAGC
TRN  10010101100011000
NAM  ENV_RSVP/160-406
ASQ  LNVSM-WDEPPELQLLGSQSLPNVTNITQVSGVAGGCVYFAPR--ATGLFLG-WSKQGLSRFLLRHP-----FTSTSNSTEPFTVVTADRHNLFMGSEYCGAYGY-RFWEIYNCSQTR-NTYRCGDVG-G.TGLPETWCRGKGGIWVNQSKEINETEPFSFTANCTGSNLGNVSG-CCGEPITILPLGAWIDSTQGSFTKPKALPPAIFLICGDRAWQGIPSRPVGGPCYLGKLTMLAPNHTDILKILANSSRTGIRR-KRS
NAM  O73908_CHICK/16-248
ASQ  LNTTLPWD-PQELDILGSQMIKNGTTRTCVT-FGSVCYKENNRSRVCHNFDGNFNGTGGAEAELRD------FIEKWKSDDLLIRPYVNQSWTMVSPINVESFSISRRYCGFTSNETH---YYRGDLS--.-----NWCGSKRGKWS--AGYRNGTKCSSNTTGCGGNCTTEWNYYAYGFTFGKQPEVLWNNGTA------KALPPGIFLICGDRAWQGIPRNALGGPCYLGQLTMLSPNFTTWITYGPN--ITGHRRSRRS
DSQ  CTAAATACAACCCTCCCTTGGGAC---CCCCAAGAATTGGATATTTTAGGGTCCCAGATGATCAAGAACGGAACAACACGTACGTGTGTTACC---TTTGGGTCGGTGTGCTATAAAGAGAACAATCGCAGTAGAGTCTGTCACAATTTTGATGGGAATTTTAATGGGACTGGTGGGGCAGAAGCAGAATTGCGTGAC------------------TTCATAGAAAAATGGAAAAGTGATGACCTTCTTATAAGGCCCTATGTCAACCAATCATGGACGATGGTAAGTCCAATAAACGTAGAGAGTTTTTCAATAAGTCGTAGATATTGTGGATTCACCAGTAACGAGACTCAT---------TACTATAGAGGGGACCTTTCT------...---------------AATTGGTGTGGTTCAAAAAGGGGAAAATGGTCA------GCGGGGTACAGGAATGGGACAAAATGTTCCAGCAACACGACGGGTTGCGGTGGTAATTGCACGACGGAATGGAATTATTATGCATATGGGTTTACCTTCGGGAAACAGCCAGAGGTGTTGTGGAACAATGGGACTGCT------------------AAGGCACTCCCACCAGGTATTTTCTTGATTTGTGGGGACAGGGCTTGGCAAGGCATCCCGCGTAATGCCTTGGGAGGGCCCTGTTATCTAGGACAATTGACTATGCTCTCTCCCAACTTTACCACCTGGATAACATATGGGCCGAAC------ATTACGGGTCACCGCCGTAGCAGGCGCTCG
TRN  10010101110011000
//