EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03686 - UPF0146)
FAM  PF03686
PID  UPF0146
DES  Uncharacterised protein family (UPF0146)
IPR  IPR005353
ANO  6
ALN  135
AID  0.371954
APH  ((YA00_METTH/2-128:0.92634,(Y688_METJA/6-135:0.61693,(Y194_PYRAB/1-131:0.24266,Y209_PYRHO/1-131:0.27776):0.30681):0.22770):0.22138,Y2609_HALN1/1-129:1.03456,Y73A_ARCFU/3-126:0.27231);
ATP  ((YA00_METTH/2-128,(Y688_METJA/6-135,(Y194_PYRAB/1-131,Y209_PYRHO/1-131))),Y2609_HALN1/1-129,Y73A_ARCFU/3-126);
ATL  4.12645
DNO  3
DLN  405
DID  0.513264
DPH  (Y209_PYRHO/1-131:0.18623,Y194_PYRAB/1-131:0.27717,YA00_METTH/2-128:0.87250);
DTP  (Y209_PYRHO/1-131,Y194_PYRAB/1-131,YA00_METTH/2-128);
DTL  1.3359
RID  0.439961
RPH  (Y209_PYRHO/1-131:0.23613,Y194_PYRAB/1-131:0.30414,YA00_METTH/2-128:1.41929);
RTP  (Y209_PYRHO/1-131,Y194_PYRAB/1-131,YA00_METTH/2-128);
RTL  1.95956
LNK  Y194_PYRAB/1-131:Q9V280:AJ248283
LNK  Y209_PYRHO/1-131:O57948:AP000001
LNK  Y2609_HALN1/1-129:P58015:
LNK  Y688_METJA/6-135:Q58101:
LNK  Y73A_ARCFU/3-126:P58014:
LNK  YA00_METTH/2-128:O27081:AE000872
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Y209_PYRHO/1-131
ASQ  MIEVAEIIAREIRRG-KIVEIGVGFYLEVAKRLRESG-IDILVVDINEKAINYARKQGIKGVVDDIFNPTLGIYKDAKAIYSIRPAPEMMKPLLDLARKLKIPLYIVPLTGDRT--PNGMKLINYKGIPIYKWEP
DSQ  ATGATCGAGGTTGCAGAGATAATAGCAAGGGAAATTAGAAGGGGA---AAAATCGTCGAGATTGGAGTAGGCTTCTACTTAGAGGTTGCTAAAAGGCTAAGAGAATCAGGA---ATTGATATCCTCGTAGTAGATATCAATGAAAAAGCAATTAATTATGCAAGAAAGCAGGGAATCAAAGGAGTTGTTGATGATATCTTCAATCCAACCTTAGGGATATACAAGGATGCCAAGGCAATTTATTCAATAAGACCAGCACCCGAGATGATGAAACCCCTCCTCGATCTTGCAAGGAAACTAAAAATTCCACTTTACATAGTCCCACTTACTGGGGATAGGACT------CCAAATGGAATGAAATTAATTAACTATAAAGGAATACCAATATATAAGTGGGAGCCA
TRN  10010101110011000
NAM  Y194_PYRAB/1-131
ASQ  MIEVAEFIAREVKKG-KVIEVGIGFYTRIAKRLKELG-FDVLAIDINKDAVVNAKNSGLNAEVDDIFNPNISLYMGAKAIYSIRPTPEMMNYILKISKAVKVPAYIVPLTGDPV--PQGMKLITYRGIPIYKWEP
DSQ  ATGATCGAAGTTGCCGAGTTTATAGCGAGAGAAGTTAAAAAGGGC---AAGGTCATTGAAGTAGGGATAGGATTTTACACTAGGATAGCTAAGAGGTTAAAGGAGCTTGGC---TTTGATGTTCTCGCTATTGATATAAACAAAGATGCCGTGGTTAATGCTAAGAATTCAGGATTAAACGCGGAAGTTGATGATATCTTTAATCCCAACATTTCCCTATATATGGGAGCTAAGGCGATATATTCCATTAGACCAACGCCTGAAATGATGAACTACATACTAAAAATTTCTAAAGCCGTAAAGGTTCCAGCTTATATAGTTCCCCTAACCGGCGACCCAGTG------CCTCAGGGGATGAAGTTAATTACCTATAGGGGAATACCAATATACAAGTGGGAGCCA
TRN  10010101110011000
NAM  Y688_METJA/6-135
ASQ  IVEFIKKFAEENNCK-KIAEIGIGFKFDVARELSKY--FDLIAIDINEKAIEKAKLLGLNAYKDDLFNPNISLYKNIDLIYSIRPPRDLQPYILDLSKKVNANLIIRPLLNEMP--IKELKLKNYKGEVFYIKEK
NAM  YA00_METTH/2-128
ASQ  WNDLAVYIIRCSGPGTRVVEVGAGRFLYVSDYIRKHSKVDLVLTDIKPS--------HGGIVRDDITSPRMEIYRGAALIYSIRPPAEIHSSLMRVADAVGARLIIKPLTGEDIVTERKMKLVNYGRTYFYEYIA
DSQ  TGGAATGATCTTGCAGTTTACATAATCAGGTGCTCGGGGCCGGGAACCCGTGTTGTTGAGGTGGGTGCCGGCAGGTTCCTCTATGTTTCAGATTACATCAGGAAACATTCAAAGGTTGATTTGGTTCTTACAGATATTAAACCTTCC------------------------CATGGGGGCATTGTACGTGATGACATCACATCCCCCAGGATGGAGATCTACCGTGGTGCCGCACTCATATACTCCATAAGACCGCCGGCAGAGATCCACAGCTCCCTCATGAGGGTCGCCGATGCTGTGGGGGCGCGGCTAATAATTAAGCCCCTGACAGGGGAGGATATTGTAACGGAAAGGAAGATGAAACTTGTCAATTATGGCAGGACATACTTCTATGAATACATAGCT
TRN  10010101100011001
NAM  Y2609_HALN1/1-129
ASQ  MTQPPTVAAVLAAHS-RVVEVGIGARPDVAAALAERG-CAVTATDIEAC---TVP-ETVRFVRDDVTDPERAVYEAADAVYALRCPPELQRAVVDVAGAVGAACYLTTLGGEPVVVPVSERRTVASGALFVARDA
NAM  Y73A_ARCFU/3-126
ASQ  MLQIADYIA-ENYRG-KVVEVGIGRFTAVAELLARRG-FEVFATDVVER---RAP-EGCRFYVDDVTKPNLKIYEGASLIYSLRPPPELFSAIVEVSRKVGADCLIKPLYGDY----MEARIVNYKGAQFYLIRR
//