EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03676 - UPF0183)
FAM  PF03676
PID  UPF0183
DES  Uncharacterised protein family (UPF0183)
IPR  IPR005373
ANO  4
ALN  413
AID  0.39734
APH  ((U183_HUMAN/13-409:0.31141,U183_DROME/13-417:0.32726):0.15488,U183_ARATH/35-412:1.00269,U183_CAEEL/31-420:0.84934);
ATP  ((U183_HUMAN/13-409,U183_DROME/13-417),U183_ARATH/35-412,U183_CAEEL/31-420);
ATL  2.64558
DNO  4
DLN  1239
DID  0.466398
DPH  ((U183_HUMAN/13-409:5.81240,U183_DROME/13-417:7.23170):2.47412,U183_ARATH/35-412:13.26271,U183_CAEEL/31-420:11.96197);
DTP  ((U183_HUMAN/13-409,U183_DROME/13-417),U183_ARATH/35-412,U183_CAEEL/31-420);
DTL  40.7274
RID  0.39734
RPH  ((U183_HUMAN/13-409:0.31141,U183_DROME/13-417:0.32726):0.15488,U183_ARATH/35-412:1.00269,U183_CAEEL/31-420:0.84934);
RTP  ((U183_HUMAN/13-409,U183_DROME/13-417),U183_ARATH/35-412,U183_CAEEL/31-420);
RTL  2.64558
LNK  U183_ARATH/35-412:Q9SD33:AL132980
LNK  U183_CAEEL/31-420:P34692:X51321
LNK  U183_DROME/13-417:Q9VSH9:AE003555
LNK  U183_HUMAN/13-409:Q9BSU1:AF176088
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  U183_CAEEL/31-420
ASQ  KSSQFEFVLGMPINQCIAMIQQHPRMLTKVELKYSKKDPFYQDIIIYIGSTGIRLYFDGLSQLIKLIEVDNLSMITLTYNDTIFSDPNNMATLDRVNEFFGSTHPGSYDDKHNIYVQSWPGLSFCFPYGGENSNLEVRPGFGGNLRSLKYDANSQPKLTKMSIYRGPNPSEPESVDTPFSCYCGQNRTRKVEAIWENGN-IVGIDIQFDTQN-GRIVDGEYDVSTYTRQIYFGDSVSDVQSILGAPTKVFYKSDDKMKIHR-GLHKETLYGPPNFFFNYFVMGLDILFDFVSKRVVKFVLHTNAPGHCDFGMYSRCNFSIFLNDKQYEIR---------------TDSKFDEFSHAFMNDSNP-PRPVVLARQEQ----QPFGSTFCYGIKQIIVERTENGFLTSVTIYDGAK
DSQ  AAAAGTTCACAATTCGAATTTGTGCTTGGTATGCCAATCAATCAATGTATTGCAATGATTCAGCAACATCCAAGAATGCTTACAAAAGTCGAATTGAAGTACAGTAAAAAGGATCCATTCTACCAGGATATCATCATCTATATCGGTTCTACAGGAATTCGTCTCTATTTTGATGGCCTTTCACAGCTTATCAAGCTAATTGAAGTGGATAATCTTTCAATGATTACACTTACTTATAACGATACAATCTTCTCTGATCCAAATAACATGGCGACGTTGGATCGGGTCAACGAATTTTTTGGATCGACACATCCAGGATCATATGATGATAAGCACAATATCTATGTGCAAAGTTGGCCGGGATTATCTTTCTGTTTCCCATATGGAGGAGAAAATTCGAATTTGGAAGTCAGGCCTGGATTTGGTGGAAATCTTCGTTCGCTGAAATATGATGCCAACTCTCAACCAAAACTTACCAAGATGTCCATTTATCGTGGACCAAATCCATCTGAGCCAGAATCCGTGGATACTCCATTCTCGTGTTATTGTGGTCAAAATCGGACGAGAAAAGTCGAAGCAATTTGGGAAAATGGGAAT---ATTGTTGGAATTGATATTCAATTTGATACTCAAAAC---GGAAGAATTGTCGATGGAGAGTATGATGTATCCACGTACACACGACAAATCTATTTTGGAGACTCTGTTTCGGATGTGCAATCGATTCTTGGAGCCCCGACAAAGGTCTTCTACAAGTCCGATGACAAGATGAAAATTCATCGT---GGACTTCACAAGGAGACACTCTATGGACCACCAAATTTCTTCTTCAACTACTTTGTAATGGGATTGGATATTCTGTTTGATTTTGTCTCGAAGCGTGTTGTCAAATTCGTTCTTCATACCAATGCACCAGGACACTGTGACTTTGGAATGTACTCACGATGCAACTTTTCAATCTTCTTGAATGACAAGCAATACGAGATTCGT---------------------------------------------ACGGATTCAAAGTTCGATGAATTCTCGCACGCCTTCATGAATGACTCAAATCCG---CCTCGTCCAGTGGTTCTTGCTCGCCAAGAGCAA------------CAACCATTTGGATCCACATTCTGCTACGGAATCAAACAAATTATTGTCGAAAGAACCGAGAATGGATTCCTCACTTCAGTCACCATTTATGATGGAGCCAAG
TRN  10010101100011000
NAM  U183_HUMAN/13-409
ASQ  GNEQWEFTLGMPLAQAVAILQKHCRIIKNVQVLYSEQSPLSHDLILNLTQDGIKLMFDAFNQRLKVIEVCDLTKVKLKYCGVHFNSQAIAPTIEQIDQSFGATHPGVYNSAEQLFHLNFRGLSFSFQLDSWTEAPKYEPNFAHGLASLQIPHGAT--VKRMYIYSGNSLQDTKAPMMPLSCFLGNVYAESVDVLRDGTG-PAGLRLRLLAAGCGPGLLADAKMRVFERSVYFGDSCQDVLSMLGSPHKVFYKSEDKMKIHSPSPHKQVPSKCNDYFFNYFTLGVDILFDANTHKVKKFVLHTNYPGHYNFNIYHRCEFKIPLAIKKENADG-----------QTETCTTYSKWDNIQELLGHPVEKPVVLHRSSSPNNTNPFGSTFCFGLQRMIFEVMQNNHIASVTLYG--P
DSQ  GGGAACGAGCAATGGGAATTCACGCTGGGAATGCCTCTGGCTCAGGCAGTAGCCATTCTTCAGAAGCACTGTCGCATCATCAAAAACGTCCAGGTTCTCTACAGTGAACAGTCTCCTCTAAGCCATGACCTCATTCTTAACCTGACTCAGGACGGGATCAAACTAATGTTTGATGCTTTCAATCAGAGACTTAAGGTGATCGAAGTATGTGATTTGACTAAAGTAAAGTTAAAATATTGTGGCGTGCATTTTAATTCTCAGGCCATAGCTCCTACCATTGAACAGATTGACCAGTCTTTTGGCGCAACCCATCCTGGAGTGTACAACTCCGCTGAGCAGCTCTTCCATCTCAACTTCAGAGGACTGTCTTTCTCTTTTCAGTTAGACTCATGGACTGAGGCTCCAAAGTATGAGCCCAATTTTGCCCATGGCCTGGCTTCTCTCCAGATACCCCATGGAGCAACT------GTAAAACGAATGTACATCTACAGTGGCAACAGCCTGCAGGATACCAAGGCTCCCATGATGCCTCTGAGCTGTTTCCTGGGCAATGTCTATGCTGAGAGTGTAGATGTTCTTCGAGATGGAACTGGA---CCTGCAGGTTTACGACTTCGCCTACTTGCTGCAGGTTGTGGACCTGGCCTATTAGCAGATGCCAAGATGCGGGTATTTGAACGTTCAGTGTATTTTGGTGATTCCTGCCAAGATGTTCTTAGCATGCTTGGCTCTCCACACAAAGTCTTCTATAAATCAGAAGACAAGATGAAAATTCATTCTCCTTCCCCTCATAAACAAGTTCCATCGAAGTGTAATGACTACTTTTTTAACTACTTCACTCTTGGAGTGGACATCCTCTTTGATGCGAATACACACAAAGTGAAGAAGTTTGTTCTACACACCAATTACCCTGGGCATTATAATTTCAACATTTATCATCGCTGTGAGTTCAAGATCCCACTAGCCATAAAGAAAGAAAACGCAGATGGT---------------------------------CAGACAGAAACATGCACGACCTACAGCAAGTGGGACAACATCCAGGAGCTCCTGGGCCACCCTGTGGAGAAGCCTGTTGTCCTGCACAGGTCTTCCTCCCCAAACAACACCAACCCATTTGGTTCCACATTCTGCTTTGGTCTTCAGCGAATGATCTTTGAGGTCATGCAGAACAACCACATTGCCTCGGTGACCCTGTATGGC------CCC
TRN  10010101100011000
NAM  U183_DROME/13-417
ASQ  GCDAWEFVLGMHFSQAIAIIQSQVGIIKGVQVLYSDTTPLGVDIIINLPQDGVRLIFDPVSQRLKTIEVFNMKLVKLRYFGVYFNSPEVLPSIEQIEHSFGATHPGVYDAAKQLFALHFRGLSFYFPVDS-----KLHSGYAHGLSSLVFLNGASPVVSKMSLYAGSNVLENRVPSLPLSCYHRQMYLESATVLRTAFGHTKGLKLKLFTEGSGRAL--EPRRQCFTRELLFGDSCEDVATSLGAPNRIFFKSEDKMKIHSSSVNRQAQSKRSDIFFNYFTLGIDVLFDARTQTCKKFILHTNYPGHFNFNMYHRCEFQFLLQADHPSMSDSGHDLVTPTKQEHVNITAYTKWDAISSALATS-ERPVVLHRASSTNTANPFGSTFCYGYQDLIFEVMPNSHIASVTLYNTAP
DSQ  GGCTGCGATGCCTGGGAATTTGTGCTGGGCATGCACTTCTCGCAGGCTATCGCCATCATCCAGTCGCAGGTGGGCATCATCAAGGGAGTCCAGGTGCTGTACTCGGATACCACTCCCCTGGGCGTGGACATCATTATCAACCTGCCACAGGATGGCGTTCGCTTGATCTTTGATCCCGTCAGTCAGCGTTTGAAGACCATCGAGGTTTTCAACATGAAACTGGTGAAGCTGCGGTATTTCGGCGTATACTTCAATTCCCCGGAGGTGCTGCCGAGTATCGAGCAAATCGAGCACTCCTTTGGAGCCACACATCCTGGGGTTTACGATGCAGCCAAACAATTGTTTGCTCTACACTTTCGCGGGCTGAGTTTCTACTTTCCGGTGGACAGC---------------AAGCTGCACTCGGGCTACGCCCATGGACTGAGTTCTCTGGTTTTCCTGAATGGCGCCTCACCCGTCGTGTCCAAGATGTCTCTCTACGCAGGCAGCAATGTGTTGGAGAACAGGGTACCATCTCTTCCCTTGTCCTGCTATCACCGCCAGATGTATTTGGAATCGGCCACTGTTCTCCGAACCGCCTTTGGTCACACGAAGGGTCTGAAGCTGAAGCTCTTTACTGAGGGTTCAGGAAGGGCTTTG------GAGCCACGCCGTCAGTGCTTTACGCGAGAGCTGCTCTTCGGCGATAGCTGCGAGGATGTGGCCACCAGTCTTGGAGCACCCAATCGTATATTCTTCAAGAGCGAGGACAAAATGAAGATACACAGCTCGAGTGTCAATCGACAAGCACAGAGCAAGCGAAGCGATATTTTCTTTAACTACTTTACACTTGGCATCGATGTGCTCTTTGATGCACGGACGCAGACCTGCAAGAAATTCATTCTGCACACCAACTACCCCGGTCACTTCAACTTTAATATGTACCATCGCTGCGAGTTCCAGTTCCTGCTGCAGGCGGATCACCCTTCGATGAGTGATAGTGGTCACGATTTGGTGACGCCGACTAAGCAGGAACATGTGAACATAACCGCCTACACCAAATGGGACGCGATCAGCAGCGCATTGGCCACCTCA---GAGCGGCCAGTGGTGCTGCATCGCGCCAGCTCGACGAACACAGCGAATCCGTTCGGCTCCACCTTTTGCTATGGCTACCAAGACCTGATTTTCGAGGTGATGCCCAATAGCCACATCGCCTCGGTAACGCTCTACAATACTGCGCCT
TRN  10010101100011001
NAM  U183_ARATH/35-412
ASQ  GVGIGPFSIGMPICEAFAQIEQQPNIYDVVHVKYYDEDPLKLDVVISFPDHGFHLRFDPWSQRLRLVEIFDVKRLQMRYATSMIGGPSTLATFVAVYALFGPTFPGIYDKERGIYSLFYPGLSFEFPIPNQYTDCCHD---GEAALPLEFPDGTTPVTCRVSIYDNSS--DKKVGVGKLMDRASVPPLPPGSLYMEEVHVKPGKELYF---------------TVGGQHMPFGASPQDVWTELGRPCGIHPKQVDQMVIHSASDPRPKTTICGDYFYNYFTRGLDILFDGETHKVKKFVLHTNYPGHADFNSYIKCNFVISAGADAAEANR-----------SGNKITPSTNWDQVKEILGECGPAAIQTQGSTS----NPFGSTYVYGYQNVAFEVMHFCNNPRFSNFDPCY
DSQ  GGCGTCGGCATCGGACCTTTCTCTATCGGAATGCCGATTTGTGAAGCATTTGCTCAAATAGAGCAGCAGCCTAACATATATGATGTTGTTCATGTTAAATACTACGACGAGGATCCTTTGAAACTGGATGTTGTTATTAGCTTTCCAGATCATGGGTTTCATCTTCGATTTGATCCCTGGTCTCAGAGGTTACGGCTTGTTGAAATATTTGATGTCAAGCGGCTTCAGATGCGCTACGCCACTTCTATGATTGGGGGTCCATCAACTCTGGCAACGTTTGTGGCTGTTTATGCACTTTTTGGACCAACCTTTCCTGGGATTTATGATAAAGAAAGAGGGATTTATTCTCTGTTCTACCCGGGGCTATCCTTCGAGTTTCCAATTCCAAACCAGTACACGGACTGCTGCCATGAT---------GGAGAAGCGGCACTACCGTTAGAGTTTCCAGATGGCACCACACCAGTAACATGCCGGGTCTCTATATATGACAACTCAAGT------GACAAAAAAGTTGGTGTCGGAAAATTGATGGATAGAGCTTCTGTTCCTCCTCTACCTCCTGGCAGTCTGTATATGGAAGAAGTTCATGTCAAGCCTGGCAAGGAACTATACTTT---------------------------------------------ACTGTTGGAGGCCAGCATATGCCTTTTGGTGCATCACCACAGGATGTATGGACTGAATTAGGTCGACCTTGTGGGATCCACCCAAAGCAGGTAGATCAAATGGTTATTCATTCTGCGTCAGATCCTCGACCAAAAACAACTATCTGTGGTGATTACTTTTACAACTATTTTACTCGTGGTTTGGACATCCTGTTTGATGGCGAGACTCACAAAGTTAAAAAGTTTGTTCTTCACACCAACTATCCGGGTCATGCTGATTTCAACTCATACATAAAGTGCAACTTTGTGATTTCGGCTGGAGCGGATGCGGCAGAAGCAAACAGA---------------------------------AGTGGAAACAAGATCACTCCAAGCACTAACTGGGATCAGGTCAAGGAAATACTCGGGGAATGTGGGCCAGCAGCTATTCAGACGCAAGGCTCAACGAGC------------AACCCTTTTGGATCTACATATGTGTATGGCTATCAGAATGTTGCTTTTGAGGTAATGCATTTTTGTAATAACCCTAGATTCAGTAACTTTGATCCTTGTTAT
TRN  10010101100011000
//