EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03672 - UPF0154)
FAM  PF03672
PID  UPF0154
DES  Uncharacterised protein family (UPF0154)
IPR  IPR005359
ANO  5
ALN  64
AID  0.401195
APH  ((Y33A_MYCGE/10-73:0.31789,Y265_UREPA/46-109:0.46912):0.13010,YNBE_LACLA/8-71:0.77985,(Y2350_BACHD/7-70:0.20247,YNEF_BACSU/8-70:0.11159):0.69655);
ATP  ((Y33A_MYCGE/10-73,Y265_UREPA/46-109),YNBE_LACLA/8-71,(Y2350_BACHD/7-70,YNEF_BACSU/8-70));
ATL  2.70757
DNO  5
DLN  192
DID  0.502348
DPH  ((YNEF_BACSU/8-70:0.16601,Y2350_BACHD/7-70:0.21231):0.36337,(YNBE_LACLA/8-71:0.69738,Y33A_MYCGE/10-73:0.33399):0.08649,Y265_UREPA/46-109:0.31160);
DTP  ((YNEF_BACSU/8-70,Y2350_BACHD/7-70),(YNBE_LACLA/8-71,Y33A_MYCGE/10-73),Y265_UREPA/46-109);
DTL  2.17115
RID  0.401195
RPH  ((Y33A_MYCGE/10-73:0.31789,Y265_UREPA/46-109:0.46912):0.13010,YNBE_LACLA/8-71:0.77985,(Y2350_BACHD/7-70:0.20247,YNEF_BACSU/8-70:0.11159):0.69655);
RTP  ((Y33A_MYCGE/10-73,Y265_UREPA/46-109),YNBE_LACLA/8-71,(Y2350_BACHD/7-70,YNEF_BACSU/8-70));
RTL  2.70757
LNK  Y2350_BACHD/7-70:Q9KAD9:AP001515
LNK  Y265_UREPA/46-109:Q9PQM6:AE002123
LNK  Y33A_MYCGE/10-73:Q49310:U39714
LNK  YNBE_LACLA/8-71:Q9CG27:AE006360
LNK  YNEF_BACSU/8-70:P45708:X87845
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Y265_UREPA/46-109
ASQ  IGIVLFLIAGLIIGYFISMKIMKRQLKKNPPISKDTIRMIYQQVGRKPSESQINEIYNRAVKQK
DSQ  ATTGGAATTGTTTTATTTTTAATCGCAGGACTTATTATCGGTTATTTTATTTCGATGAAAATTATGAAACGCCAATTGAAGAAGAATCCACCAATTTCAAAGGATACAATTCGTATGATTTATCAACAAGTAGGACGTAAGCCAAGTGAGTCACAAATTAATGAGATTTATAATCGGGCAGTAAAACAAAAA
TRN  11011101111011000
NAM  Y33A_MYCGE/10-73
ASQ  LGIPLSLLVGMILGYFISIKIFKKQMRDNPPITENQIKAMYAKMGRKLSETQVKEIMRSIKNQK
DSQ  TTAGGTATCCCTCTTTCGCTTTTGGTGGGAATGATTCTTGGTTATTTTATTTCTATAAAAATCTTTAAAAAACAGATGCGTGACAATCCACCTATTACTGAAAATCAAATTAAAGCAATGTATGCAAAAATGGGTAGAAAATTATCTGAAACCCAGGTAAAAGAGATAATGCGCTCCATTAAAAACCAAAAA
TRN  10010101110011010
NAM  YNBE_LACLA/8-71
ASQ  LLMVVCLLAGFFLGTWFSQRQTKKLLMDNPPLNEDAVRLMMGSMGRKPSEVQVQQVLRQIRAAA
DSQ  TTGCTTATGGTTGTATGCCTTTTGGCAGGTTTTTTCTTGGGAACATGGTTCTCACAACGCCAAACAAAAAAATTACTTATGGATAACCCACCCCTTAATGAAGACGCTGTTCGTCTTATGATGGGATCTATGGGACGTAAACCAAGTGAAGTTCAAGTCCAACAAGTTCTTCGCCAAATTCGTGCTGCTGCA
TRN  11011101111011000
NAM  YNEF_BACSU/8-70
ASQ  LVGVVALLIGVALGFFIARKYMMSYLKKNPPINEQMLRMMMMQMGMKPSQKKINQMMKAMNN-Q
DSQ  CTAGTGGGCGTTGTTGCATTGCTCATAGGTGTTGCACTCGGGTTTTTTATTGCTCGTAAATATATGATGAGCTACCTGAAAAAGAATCCGCCTATTAATGAACAAATGTTACGCATGATGATGATGCAAATGGGAATGAAACCTTCTCAAAAGAAAATCAATCAAATGATGAAAGCCATGAATAAT---CAA
TRN  10010101100011010
NAM  Y2350_BACHD/7-70
ASQ  LWITLGIVIGIAIGFFIARKTMMSYLKKNPPINEQMLRVMLMQMGQNPSQKKINQMMKAMQKQQ
DSQ  CTTTGGATTACATTAGGTATTGTCATCGGTATTGCGATTGGCTTTTTTATTGCTCGTAAGACGATGATGTCCTATTTGAAGAAAAACCCACCCATCAATGAGCAAATGCTTCGCGTCATGTTAATGCAAATGGGGCAAAACCCTTCGCAGAAGAAGATTAATCAAATGATGAAAGCGATGCAGAAGCAGCAA
TRN  11011101111011010
//