EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03668 - ATP_bind_2)
FAM  PF03668
PID  ATP_bind_2
DES  P-loop ATPase protein family
IPR  IPR005337
ANO  4
ALN  287
AID  0.445516
APH  ((YVCJ_BACSU/9-292:0.39058,Y1456_MYCBO/17-301:0.60524):0.58039,YHBJ_ECOLI/1-282:0.20061,Y1146_HAEIN/1-282:0.30267);
ATP  ((YVCJ_BACSU/9-292,Y1456_MYCBO/17-301),YHBJ_ECOLI/1-282,Y1146_HAEIN/1-282);
ATL  2.0795
DNO  3
DLN  861
DID  0.470724
DPH  (YHBJ_ECOLI/1-282:0.55653,YVCJ_BACSU/9-292:0.36127,Y1456_MYCBO/17-301:0.49735);
DTP  (YHBJ_ECOLI/1-282,YVCJ_BACSU/9-292,Y1456_MYCBO/17-301);
DTL  1.41515
RID  0.423561
RPH  (YHBJ_ECOLI/1-282:0.72794,YVCJ_BACSU/9-292:0.37454,Y1456_MYCBO/17-301:0.60740);
RTP  (YHBJ_ECOLI/1-282,YVCJ_BACSU/9-292,Y1456_MYCBO/17-301);
RTL  1.70988
LNK  Y1146_HAEIN/1-282:P45071:
LNK  Y1456_MYCBO/17-301:P67107:BX248338
LNK  YHBJ_ECOLI/1-282:P33995:Z27094
LNK  YVCJ_BACSU/9-292:O06973:Z94043
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Y1146_HAEIN/1-282
ASQ  MEIIIISGRSGAGKSVALRALEDAGYYCVDNIPLDLLPQLTDILS---QSQSSVAISLDIRNIPNSAHSLKQTLSTLQK-HHQIKIIFLEADRATLIRRYSDSRRLHPLSLKDLSLEAAIDEEYRYLEPLIQHANLILDTTHLSTHSLAERLREFLRGNSEKELKIIVESFGFKYGIPLDADYVFDVRFLPNPHWDPTLRPMTGLEAPVAEFLNSHTEVNEFIYLTRHYIDTWLPMLEKNNRSYLTIAIGCTGGKHRSVYIAQQLGEYFQAKGKTVK-IQHKSLERN
NAM  YHBJ_ECOLI/1-282
ASQ  MVLMIVSGRSGSGKSVALRALEDMGFYCVDNLPVVLLPDLARTLA---DREISAAVSIDVRNMPESPEIFEQAMSNLPD-AFSPQLLFLDADRNTLIRRYSDTRRLHPLSSKNLSLESAIDKESDLLEPLRSRADLIVDTSEMSVHELAEMLRTRLLGKRERELTMVFESFGFKHGIPIDADYVFDVRFLPNPHWDPKLRPMTGLDKPVAAFLDRHTEVHNFIYQTRSYLELWLPMLETNNRSYLTVAIGCTGGKHRSVYIAEQLADYFRSRGKNVQ-SRHRTLEKR
DSQ  ATGGTACTGATGATCGTCAGCGGACGTTCAGGTTCAGGTAAATCTGTCGCCCTGCGTGCGCTGGAAGATATGGGTTTTTACTGCGTGGATAACCTTCCCGTAGTGTTGTTACCCGATCTGGCTCGAACCCTGGCC---------GATCGCGAGATTTCTGCCGCCGTCAGCATTGATGTTCGTAATATGCCGGAGTCACCAGAAATATTCGAACAGGCGATGAGTAACCTGCCTGAC---GCTTTCTCACCGCAACTCCTGTTCCTGGATGCCGACCGTAATACCTTAATTCGTCGTTACAGTGACACGCGCCGACTGCATCCGCTTTCCAGCAAAAACCTGTCGCTGGAAAGTGCTATCGACAAAGAAAGCGATTTGCTGGAGCCTCTGCGTTCGCGAGCGGATCTGATTGTCGATACCTCAGAAATGTCCGTTCACGAGCTGGCTGAAATGCTGCGTACCCGTCTGCTGGGTAAACGTGAACGCGAACTGACCATGGTCTTTGAGTCTTTCGGCTTCAAACACGGTATCCCTATCGATGCAGATTACGTCTTTGACGTGCGCTTCTTGCCGAACCCGCACTGGGATCCGAAACTGCGTCCAATGACAGGTCTTGATAAACCTGTCGCCGCGTTCCTCGACCGCCACACAGAAGTACACAATTTTATCTACCAGACGCGAAGCTATCTTGAGCTATGGTTACCTATGCTGGAAACCAACAACCGTAGCTACTTGACGGTCGCCATTGGTTGTACCGGCGGGAAGCACCGTTCGGTGTATATTGCAGAGCAACTGGCAGACTACTTCCGCTCGCGCGGTAAAAACGTCCAG---TCACGCCATCGTACGCTGGAAAAACGT
TRN  10010101100011000
NAM  YVCJ_BACSU/9-292
ASQ  IQLVIITGMSGAGKTVAIQSFEDLGYFCVDNLPPSLLPKFLELMKESNSKMSKVALVMDLRGREFFDRLIEALDEMAENPWITPRILFLDAKDSILVTRYKETRRSHPLAATGLPLEG-IALERELLEELKGRSQIIYDTSDMKPRDLREKIVKHFATNQGETFTVNVMSFGFKYGIPIDADLVFDVRFLPNPYYIESMRPLTGKDKEVSSYVMKWNETQKFNEKLIDLLSFMLPSYKREGKSQVVIAIGCTGGQHRSVTLAENLADYFKKDYYTHV--THRDIEKR
DSQ  ATTCAGCTTGTCATTATAACTGGAATGTCGGGAGCGGGGAAAACTGTCGCGATCCAAAGCTTTGAAGATCTCGGCTATTTCTGCGTCGATAATCTTCCGCCTTCATTGCTTCCGAAGTTTTTAGAGCTGATGAAGGAATCAAATTCGAAAATGAGCAAAGTTGCGCTCGTGATGGATTTGCGCGGCCGCGAATTTTTTGACCGGCTGATTGAAGCGCTGGATGAAATGGCCGAAAATCCGTGGATCACACCGCGAATTTTATTCCTGGACGCGAAGGATTCCATTCTCGTCACAAGATATAAAGAAACGAGACGCTCGCATCCGCTGGCAGCGACTGGCCTGCCGCTTGAAGGC---ATCGCGCTAGAACGAGAGCTGCTTGAGGAATTAAAAGGCCGCTCTCAAATCATTTACGATACGTCTGACATGAAGCCGCGTGATTTGCGTGAAAAAATCGTGAAGCACTTTGCGACAAACCAAGGAGAGACATTTACCGTAAATGTGATGTCATTTGGTTTTAAATACGGTATTCCAATTGATGCAGATCTCGTCTTTGATGTCAGATTTTTGCCGAATCCGTACTATATCGAAAGCATGCGGCCGCTGACTGGCAAGGATAAAGAGGTTTCCTCTTACGTCATGAAGTGGAATGAAACGCAAAAGTTCAATGAGAAATTAATTGATCTGCTGAGCTTTATGCTTCCATCTTACAAAAGAGAAGGAAAAAGCCAGGTTGTCATTGCGATCGGCTGCACAGGGGGCCAGCACCGCTCTGTGACATTAGCCGAGAATTTAGCTGATTATTTCAAAAAGGATTACTATACTCATGTT------ACTCACCGGGACATTGAAAAGAGA
TRN  10010101100011000
NAM  Y1456_MYCBO/17-301
ASQ  IDVVLVTGLSGAGRGTAAKVLEDLGWYVADNLPPQLITRMVDFGLAAGSRITQLAVVMDVRSRGFTGDLDSVRNELATR-AITPRVVFMEASDDTLVRRYEQNRRSHPLQGEQTLAEG-IAAERRMLAPVRATADLIIDTSTLSVGGLRDSIERAFGGDGGATTSVTVESFGFKYGLPMDADMVMDVRFLPNPHWVDELRPLTGQHPAVRDYVLHRPGAAEFLESYHRLLSLVVDGYRREGKRYMTIAIGCTGGKHRSVAIAEALMGLLRSDQQLSVRALHRDLGRE
DSQ  ATCGACGTCGTCTTGGTAACCGGGCTGTCCGGGGCCGGGCGCGGCACGGCGGCTAAAGTGCTGGAAGACCTGGGCTGGTATGTGGCCGACAATCTGCCGCCCCAGCTGATTACCCGCATGGTGGACTTCGGGCTGGCCGCCGGATCACGGATCACCCAGCTGGCGGTGGTAATGGATGTGCGATCGCGCGGATTCACCGGCGACCTCGATTCGGTCCGCAACGAGCTGGCCACGCGT---GCCATCACCCCGCGTGTGGTGTTCATGGAGGCGTCCGATGACACGTTGGTGCGCCGCTACGAACAGAATCGCCGCAGTCATCCGCTGCAGGGTGAGCAGACTCTGGCCGAGGGC---ATTGCCGCAGAGCGCAGGATGCTAGCACCGGTTCGCGCCACCGCCGACCTGATCATCGACACGTCGACACTGTCGGTGGGGGGCTTAAGGGATAGCATCGAGCGTGCCTTCGGCGGTGATGGCGGCGCGACCACCAGCGTCACCGTTGAATCCTTCGGGTTCAAGTACGGCCTGCCGATGGACGCCGACATGGTCATGGACGTGCGGTTCCTGCCGAACCCGCACTGGGTGGACGAGTTGCGGCCACTGACCGGCCAACATCCGGCCGTGCGCGACTATGTGCTGCACCGGCCGGGCGCGGCTGAGTTCCTCGAGTCCTACCATCGGTTGCTATCCCTGGTTGTCGACGGCTACCGTCGAGAGGGGAAGCGCTATATGACAATCGCCATCGGCTGTACCGGTGGTAAGCATCGCAGCGTCGCGATCGCTGAAGCACTGATGGGACTTCTGCGCTCCGATCAGCAACTGTCGGTGCGGGCGCTGCACCGGGATCTGGGTCGCGAA
TRN  10010101100011000
//