EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03650 - UPF0041)
FAM  PF03650
PID  UPF0041
DES  Uncharacterised protein family (UPF0041)
IPR  IPR005336
ANO  6
ALN  128
AID  0.349357
APH  (YNFD_CAEEL/11-135:0.18979,((YAI9_SCHPO/1-118:0.48269,YXX3_CAEEL/22-127:0.42181):0.18070,(YHW2_YEAST/5-126:0.19875,YG56_YEAST/5-130:0.13126):0.29537):1.20690,YGI0_YEAST/11-129:0.82742);
ATP  (YNFD_CAEEL/11-135,((YAI9_SCHPO/1-118,YXX3_CAEEL/22-127),(YHW2_YEAST/5-126,YG56_YEAST/5-130)),YGI0_YEAST/11-129);
ATL  3.93469
DNO  6
DLN  384
DID  0.454486
DPH  (YNFD_CAEEL/11-135:0.38880,((YAI9_SCHPO/1-118:0.43346,YXX3_CAEEL/22-127:0.28796):0.10047,(YHW2_YEAST/5-126:0.21477,YG56_YEAST/5-130:0.23243):0.17812):0.59106,YGI0_YEAST/11-129:0.46929);
DTP  (YNFD_CAEEL/11-135,((YAI9_SCHPO/1-118,YXX3_CAEEL/22-127),(YHW2_YEAST/5-126,YG56_YEAST/5-130)),YGI0_YEAST/11-129);
DTL  2.89635
RID  0.349357
RPH  (YNFD_CAEEL/11-135:0.18979,((YAI9_SCHPO/1-118:0.48269,YXX3_CAEEL/22-127:0.42181):0.18070,(YHW2_YEAST/5-126:0.19875,YG56_YEAST/5-130:0.13126):0.29537):1.20690,YGI0_YEAST/11-129:0.82742);
RTP  (YNFD_CAEEL/11-135,((YAI9_SCHPO/1-118,YXX3_CAEEL/22-127),(YHW2_YEAST/5-126,YG56_YEAST/5-130)),YGI0_YEAST/11-129);
RTL  3.93469
LNK  YAI9_SCHPO/1-118:Q09896:Z67757
LNK  YG56_YEAST/5-130:P53311:Z73028
LNK  YGI0_YEAST/11-129:P53157:Z72602
LNK  YHW2_YEAST/5-126:P38857:U00027
LNK  YNFD_CAEEL/11-135:Q21828:Z32683
LNK  YXX3_CAEEL/22-127:O01578:U97191
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  YGI0_YEAST/11-129
ASQ  RSFLQKYINKETLKYIFTTHFWGPVSNFGIPIAAIYDLKKDPTLISGPMTFALVTYSGVFMKYALSVSPKNYLLFGCHLINETAQLAQGYRFL--KYTYFTTDEEKK---ALDKEWK----EKEKTGK
DSQ  CGCTCATTCCTTCAAAAATACATCAATAAAGAAACTTTGAAATATATTTTCACAACACACTTCTGGGGTCCCGTATCAAATTTCGGTATCCCAATTGCTGCTATATATGATCTGAAAAAAGACCCTACACTAATCTCTGGCCCAATGACTTTTGCTTTAGTTACCTATTCAGGTGTTTTCATGAAGTATGCTCTTTCAGTATCACCCAAAAACTACTTACTGTTTGGATGCCACCTTATTAATGAAACTGCGCAATTAGCTCAAGGCTATAGGTTTCTC------AAATACACGTATTTCACAACAGATGAGGAGAAGAAA---------GCTCTAGATAAGGAATGGAAA------------GAGAAAGAAAAAACTGGTAAA
TRN  10010101100011000
NAM  YNFD_CAEEL/11-135
ASQ  YFKQHSTAEWKHYF--LSTHFWGPVANWGLPLAALGDLKKNPDMISGPMTSALLIYSSVFMRFAWHVQPRNLLLFACHFANFSAQGAQLGRFVNHNYLHYVEDPVHHK-LMMKKEVLEHEHDAERVSL
DSQ  TATTTCAAGCAACATTCCACCGCCGAATGGAAGCATTACTTC------TTGTCAACTCATTTTTGGGGACCAGTGGCTAACTGGGGACTTCCGTTGGCTGCTCTTGGAGATTTGAAGAAAAATCCTGACATGATCAGTGGACCAATGACGTCAGCTCTTCTGATCTACTCGAGTGTTTTCATGAGATTCGCGTGGCACGTTCAACCACGAAATCTTTTGCTCTTCGCTTGCCATTTTGCCAACTTCAGTGCTCAAGGAGCTCAGCTCGGTCGATTTGTGAACCACAACTATCTGCACTACGTTGAAGATCCCGTCCACCATAAA---TTGATGATGAAAAAGGAGGTTTTGGAGCACGAACACGATGCGGAACGGGTTTCGCTC
TRN  10010101100011001
NAM  YAI9_SCHPO/1-118
ASQ  MFRAGFKRFWNHPAGPKTVHFWAPAMKWTLVLSGIGDYARSPEYLSIRQYAALCATGAIWTRWSLIVRPKNYFNATVNFFLAIVGAVQVSRIL--VYQRQQKRITAQ--SEQRTEL------ARSLAA
DSQ  ATGTTTCGTGCTGGCTTTAAACGCTTTTGGAATCACCCTGCCGGTCCCAAGACTGTTCATTTTTGGGCTCCTGCCATGAAATGGACTTTAGTCCTTTCTGGTATTGGTGATTATGCCCGTTCCCCAGAATACCTTTCTATTCGTCAATATGCCGCCTTGTGTGCCACTGGTGCTATTTGGACTCGGTGGTCTCTGATCGTTCGTCCTAAAAATTACTTTAATGCTACTGTCAACTTTTTCTTGGCCATCGTTGGTGCCGTTCAAGTTTCAAGGATTCTT------GTATATCAACGACAACAAAAACGCATCACCGCTCAA------AGTGAGCAACGTACCGAGTTG------------------GCCCGAAGCCTTGCTGCA
TRN  10010101100011000
NAM  YHW2_YEAST/5-126
ASQ  SVRFAFRRFWQSETGPKTVHFWAPTLKWGLVFAGFSDMKRPVEKISGAQNLSLLSTALIWTRWSFVIKPRNILLASVNSFLCLTAGYQLGRIA--NYRIRNGDSISQLCSYILSGAD----ESKKEIT
DSQ  TCCGTACGTTTTGCATTTAGGCGGTTCTGGCAAAGTGAGACAGGCCCCAAGACGGTGCATTTCTGGGCTCCTACTTTGAAATGGGGTCTGGTTTTCGCTGGATTCAGCGATATGAAGAGACCGGTGGAAAAAATTTCTGGTGCTCAAAATTTGTCGCTGCTATCTACTGCGCTGATTTGGACTCGTTGGTCCTTTGTCATCAAGCCAAGAAACATCTTGTTGGCTTCTGTCAACTCGTTTCTTTGTCTGACCGCTGGCTATCAATTGGGTAGAATTGCC------AACTACAGGATACGGAATGGCGACTCTATATCGCAATTGTGTAGCTATATTCTCAGCGGCGCCGAC------------GAAAGCAAAAAGGAAATTACT
TRN  10010101100011011
NAM  YG56_YEAST/5-130
ASQ  AFNFAFRRFWNSETGPKTVHFWAPTLKWGLVFAGLNDIKRPVEKVSGAQNLSLLATALIWTRWSFVIKPKNYLLASVNFFLGCTAGYHLTRIA--NFRIRNGDSFKQVIHYIIKGETPAAVAAKQTAS
DSQ  GCTTTTAATTTTGCCTTTAGAAGATTTTGGAATAGTGAAACAGGCCCTAAAACAGTACACTTCTGGGCCCCAACTTTGAAGTGGGGGCTGGTCTTCGCAGGGCTAAATGATATTAAGAGGCCTGTTGAGAAGGTATCAGGAGCACAAAATTTATCTTTATTAGCGACGGCACTGATTTGGACGCGTTGGTCGTTTGTCATCAAGCCCAAGAACTATCTGTTAGCTTCCGTCAATTTTTTCCTGGGTTGCACTGCAGGCTACCATCTAACAAGAATTGCT------AACTTTAGGATACGGAACGGTGATTCTTTTAAACAGGTTATTCACTACATAATAAAAGGGGAGACTCCTGCAGCCGTCGCAGCAAAGCAAACTGCATCC
TRN  10010101100011000
NAM  YXX3_CAEEL/22-127
ASQ  VLPAFAKPAWNHAAGPKTVFFWAPTIKWTLIGAGLADLARPADKLSLYQNSALFATGAIWTRYCLVITPINYYLSSVNFFVMCTGLAQLCRIA--HYRYQNPDWETK--------------------E
DSQ  GTGCTTCCAGCATTCGCCAAGCCGGCTTGGAATCATGCGGCCGGTCCGAAAACTGTATTTTTCTGGGCCCCAACCATCAAATGGACTCTTATCGGCGCTGGACTCGCTGATTTGGCCAGACCTGCTGATAAGCTTTCTCTTTATCAGAACTCTGCTCTCTTCGCCACTGGAGCCATCTGGACGAGATATTGCCTTGTCATCACCCCAATCAACTACTATTTGAGTAGTGTGAACTTTTTCGTCATGTGCACCGGGCTCGCCCAGCTCTGTAGAATTGCA------CATTACAGGTATCAAAATCCGGATTGGGAGACGAAG------------------------------------------------------------GAG
TRN  10010101110011011
//