EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03642 - MAP)
FAM  PF03642
PID  MAP
DES  MAP domain
IPR  IPR005298
ANO  10
ALN  88
AID  0.471665
APH  ((Q9Z4P5_STAAU/481-568:0.04508,(Q9XAS5_STAAU/376-463:0.07114,Q9S2Z4_STAAU/374-461:0.28052):0.12593):0.12360,Q9Z4J2_STAAU/432-519:0.08350,(Q9XAS5_STAAU/271-358:0.38957,(Q99QS1_STAAM/160-247:0.19026,((Q99S64_STAAM/47-134:0.54791,Q99VA9_STAAM/48-135:0.28288):0.42064,(Q99QS2_STAAM/11-98:0.21635,Q9XAS5_STAAU/489-576:0.14769):0.86197):0.15175):0.11270):0.13942);
ATP  ((Q9Z4P5_STAAU/481-568,(Q9XAS5_STAAU/376-463,Q9S2Z4_STAAU/374-461)),Q9Z4J2_STAAU/432-519,(Q9XAS5_STAAU/271-358,(Q99QS1_STAAM/160-247,((Q99S64_STAAM/47-134,Q99VA9_STAAM/48-135),(Q99QS2_STAAM/11-98,Q9XAS5_STAAU/489-576)))));
ATL  4.19091
DNO  10
DLN  264
DID  0.588552
DPH  ((((Q99S64_STAAM/47-134:0.25777,Q99VA9_STAAM/48-135:0.18756):0.36970,Q99QS1_STAAM/160-247:0.14025):0.04984,(Q9XAS5_STAAU/271-358:0.30318,(Q9Z4J2_STAAU/432-519:0.07947,(Q9Z4P5_STAAU/481-568:0.05053,(Q9XAS5_STAAU/376-463:0.04629,Q9S2Z4_STAAU/374-461:0.20398):0.09670):0.07729):0.11448):0.03026):0.49555,Q99QS2_STAAM/11-98:0.12936,Q9XAS5_STAAU/489-576:0.12751);
DTP  ((((Q99S64_STAAM/47-134,Q99VA9_STAAM/48-135),Q99QS1_STAAM/160-247),(Q9XAS5_STAAU/271-358,(Q9Z4J2_STAAU/432-519,(Q9Z4P5_STAAU/481-568,(Q9XAS5_STAAU/376-463,Q9S2Z4_STAAU/374-461))))),Q99QS2_STAAM/11-98,Q9XAS5_STAAU/489-576);
DTL  2.75971
RID  0.471665
RPH  ((Q9Z4P5_STAAU/481-568:0.04508,(Q9XAS5_STAAU/376-463:0.07114,Q9S2Z4_STAAU/374-461:0.28052):0.12593):0.12360,Q9Z4J2_STAAU/432-519:0.08350,(Q9XAS5_STAAU/271-358:0.38957,(Q99QS1_STAAM/160-247:0.19026,((Q99S64_STAAM/47-134:0.54791,Q99VA9_STAAM/48-135:0.28288):0.42064,(Q99QS2_STAAM/11-98:0.21635,Q9XAS5_STAAU/489-576:0.14769):0.86197):0.15175):0.11270):0.13942);
RTP  ((Q9Z4P5_STAAU/481-568,(Q9XAS5_STAAU/376-463,Q9S2Z4_STAAU/374-461)),Q9Z4J2_STAAU/432-519,(Q9XAS5_STAAU/271-358,(Q99QS1_STAAM/160-247,((Q99S64_STAAM/47-134,Q99VA9_STAAM/48-135),(Q99QS2_STAAM/11-98,Q9XAS5_STAAU/489-576)))));
RTL  4.19091
LNK  Q99QS1_STAAM/160-247:Q99QS1:BA000017
LNK  Q99QS2_STAAM/11-98:Q99QS2:BA000017
LNK  Q99S64_STAAM/47-134:Q99S64:BA000017
LNK  Q99VA9_STAAM/48-135:Q99VA9:BA000017
LNK  Q9S2Z4_STAAU/374-461:Q9S2Z4:AJ245439
LNK  Q9XAS5_STAAU/271-358:Q9XAS5:AJ243790
LNK  Q9XAS5_STAAU/376-463:Q9XAS5:AJ243790
LNK  Q9XAS5_STAAU/489-576:Q9XAS5:AJ243790
LNK  Q9Z4J2_STAAU/432-519:Q9Z4J2:AJ223806
LNK  Q9Z4P5_STAAU/481-568:Q9Z4P5:AJ132841
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9XAS5_STAAU/489-576
ASQ  VKFPVTINGFSNLVSNEFAFLHPHKITTNDLNAKLRLALASDQGITKHDIGLSERTVYKVYFKDGSSKFVDLKAAKQDSKVFKATDIK
DSQ  GTGAAGTTTCCAGTAACGATAAATGGATTTTCAAATTTAGTTTCAAATGAATTTGCGTTTTTACATCCACATAAAATAACAACAAACGACTTGAATGCTAAACTTAGACTAGCGTTAGCAAGCGATCAAGGTATTACTAAACATGATATTGGACTTTCTGAACGCACTGTGTATAAAGTGTATTTTAAAGACGGGTCATCAAAATTTGTTGACTTAAAAGCTGCGAAACAAGATTCAAAAGTATTTAAAGCAACTGACATTAAA
TRN  10010101110011000
NAM  Q99QS2_STAAM/11-98
ASQ  VKFPVTINKFENIVSNEFVFYNASKITINDLSIKLKSAMANDQGITKHDIGLAERAVYKVYFKNGSSKYVDLKTEYKDERVFKATDIK
DSQ  GTGAAATTCCCAGTAACAATAAATAAATTTGAAAACATAGTTTCAAATGAATTTGTGTTCTATAATGCAAGCAAAATTACAATTAATGATTTAAGTATAAAACTTAAATCAGCAATGGCAAATGATCAAGGGATAACTAAACATGACATAGGACTTGCTGAACGCGCAGTGTATAAAGTGTATTTTAAAAATGGTTCGTCAAAATATGTAGACTTAAAAACTGAGTATAAAGATGAAAGAGTATTTAAAGCAACTGACATTAAA
TRN  10010101110011000
NAM  Q99VA9_STAAM/48-135
ASQ  VPYTIAVDGIMAFNQSYLNLPKDSQLSYLDLGNKVKALLYDERGVTPEKIRNAKSAVYTITWKDGSKKEVDLKKDSYTANLFDSNSIK
DSQ  GTTCCATATACAATTGCAGTAGATGGCATTATGGCTTTCAATCAATCTTACTTAAATTTACCAAAAGATAGCCAATTATCATATTTAGATTTAGGAAATAAAGTTAAAGCTTTATTATATGATGAACGTGGTGTAACACCTGAGAAGATTCGAAATGCAAAATCTGCCGTTTACACGATTACTTGGAAAGATGGTAGTAAAAAAGAAGTGGATCTTAAGAAAGATAGCTACACAGCAAACTTGTTTGATTCAAATTCAATTAAA
TRN  11011101111011000
NAM  Q99S64_STAAM/47-134
ASQ  VPYTISVDGITALHRTYFVFPENKKVLYQEIDSKVKNELASQRGVTTEKINNAQTATYTLTLNDGNKKVVNLKKNDDAKNSIDPSTIK
DSQ  GTGCCTTACACGATCTCAGTAGATGGTATTACTGCATTACATCGAACTTACTTTGTTTTTCCAGAAAATAAAAAGGTACTTTATCAAGAAATTGACAGTAAAGTAAAAAATGAATTAGCTTCACAACGTGGTGTTACAACAGAAAAAATTAATAATGCACAAACAGCAACGTATACACTTACTTTGAATGATGGTAATAAAAAAGTAGTGAATCTAAAGAAAAATGACGACGCTAAAAATTCAATTGATCCAAGTACAATCAAA
TRN  11011101111011000
NAM  Q99QS1_STAAM/160-247
ASQ  VPYTITVNGTSQNILSNLTFNKNQNISYKDLEGKVKSVLESNRGITDVDLRLSKQAKYTVNFKNGTKKVIDLKSGIYTANLINSSDIK
DSQ  GTGCCATATACAATCACAGTGAACGGCACAAGCCAAAACATTTTATCAAACCTAACATTTAATAAAAATCAAAATATTAGTTACAAAGATTTAGAGGGTAAAGTTAAATCAGTTTTAGAATCAAATAGAGGTATTACTGATGTTGATTTAAGACTTTCGAAGCAAGCGAAATATACAGTTAATTTTAAAAATGGAACGAAGAAAGTTATCGATTTGAAATCAGGTATTTACACAGCGAATTTAATCAATTCAAGTGATATTAAA
TRN  10010101110011000
NAM  Q9S2Z4_STAAU/374-461
ASQ  VPYTIAVNGTSTPILSDLKFTGDPRVGYKDITKKVKSVLKHDRGIGERELKYAKKATYTVHFKNGKKKVINLNSKISQLNLLYVQDIK
DSQ  GTACCATACACAATTGCAGTAAATGGCACATCAACACCAATTTTATCAGATTTAAAATTTACAGGTGACCCACGTGTAGGCTACAAAGATATCACTAAAAAAGTTAAATCAGTATTGAAGCATGATAGAGGTATCGGGGAACGTGAATTAAAATATGCAAAAAAAGCAACTTACACAGTACATTTTAAAAATGGAAAGAAAAAAGTGATTAATTTAAACTCAAAAATTAGCCAACTGAATCTGCTTTATGTTCAAGATATTAAA
TRN  10010101100011000
NAM  Q9XAS5_STAAU/376-463
ASQ  VPYTIAVNGASNPTLSDLKFTGDSRVSYSDITKKVKSVLKHDRGINDIELKFAKQAKYTIHFKNGKTQVVDLKSDIFTRNLFSVKDIK
DSQ  GTACCATATACAATTGCAGTAAATGGAGCATCAAATCCAACTTTATCAGATTTAAAATTTACAGGTGACTCACGTGTAAGCTACAGTGATATCACGAAAAAAGTTAAATCAGTATTGAAACATGATAGAGGTATCAATGATATTGAATTGAAATTTGCGAAACAAGCAAAGTATACTATACACTTTAAAAATGGAAAGACACAAGTCGTTGACCTTAAATCAGATATCTTTACAAGAAATTTATTCAGTGTCAAAGATATTAAA
TRN  10010101110011000
NAM  Q9Z4P5_STAAU/481-568
ASQ  VPYTIAVNGTSTPIASKLRLSNKQLIGYQDLNKKVKSVLKHDRGINDIELKFAKQAKYTVHFKNGKTQVVDLKSDIFTRNLFSVKDIK
DSQ  GTACCATACACAATCGCAGTAAATGGGACATCAACACCTATTGCATCAAAACTAAGACTTTCGAATAAACAATTAATTGGTTATCAAGATTTAAATAAAAAAGTTAAATCAGTTTTAAAACATGATAGAGGTATCAATGATATTGAATTGAAATTTGCGAAACAAGCAAAGTATACTGTACACTTTAAAAATGGAAAGACACAAGTAGTTGACCTTAAATCAGATATCTTTACAAGAAACTTATTCAGTGTCAAAGATATTAAA
TRN  10010101110011000
NAM  Q9Z4J2_STAAU/432-519
ASQ  VPYTIAVNGTSTPILSKLKISNKQLISHKYLNDKVKSVLKSERGISDLDLKFAKQAKYTVYFKNGKKQVVNLKSDIFTPNLFSAKDIK
DSQ  GTACCATATACAATTGCAGTAAATGGCACATCAACACCAATTTTATCAAAACTTAAAATTTCGAATAAACAATTAATTAGTCACAAATATTTAAATGACAAAGTGAAATCTGTATTAAAAAGTGAAAGAGGCATCAGTGATCTTGACTTAAAATTTGCGAAACAAGCAAAATATACAGTATATTTCAAAAATGGAAAGAAACAAGTAGTGAATTTAAAATCAGACATCTTTACACCTAATTTATTTAGTGCCAAAGATATTAAA
TRN  10010101110011000
NAM  Q9XAS5_STAAU/271-358
ASQ  VPYSINLNGTTTNIQSNLAFSNKPWTNYKNLTTKVKSVLKSDRGVSERDLKHAKKAYYTVYFKNGGKRVIHLNSNIYTANLVHAKDVK
DSQ  GTGCCATATTCAATTAATTTAAATGGTACAACAACTAATATTCAATCTAATTTAGCATTTTCAAATAAACCTTGGACAAATTACAAAAATTTAACAACAAAGGTAAAATCAGTATTGAAATCTGACAGAGGCGTTAGTGAACGTGATTTGAAACACGCAAAGAAAGCGTATTACACTGTTTACTTTAAAAATGGTGGTAAAAGAGTGATACATTTAAACTCGAATATTTATACAGCTAACTTAGTTCATGCGAAAGATGTTAAG
TRN  10010101110011000
//