EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03634 - TCP)
FAM  PF03634
PID  TCP
DES  TCP family transcription factor
IPR  IPR005333
ANO  17
ALN  269
AID  0.248796
APH  (((((((((Q9C518_ARATH/44-302:0.73661,O64647_ARATH/59-280:0.80983):0.22773,(Q9SJK7_ARATH/27-186:0.76183,(Q9LSD5_ARATH/62-246:0.67111,Q9FLM6_ARATH/52-227:0.92787):0.22696):0.08601):0.17096,Q9FTA2_ARATH/15-194:0.70529):0.16492,O23875_ORYSA/40-161:0.34286):0.36987,Q9M1U4_ARATH/1-165:0.73514):0.85327,(((Q9LEZ9_ARATH/17-195:0.85109,Q9S7W5_ARATH/58-293:0.67035):0.44633,Q9LKA2_ARATH/15-280:1.02809):0.30605,Q9C758_ARATH/40-241:0.60555):0.69163):0.05657,(Q9FYG7_ARATH/77-314:0.76434,Q9XGR9_LINVU/79-321:0.66423):0.18266):0.26851,Q9FUE7_POPDE/106-351:0.68471):0.24301,Q9LII4_ARATH/132-395:1.24650,Q9CA43_ARATH/74-283:0.36865);
ATP  (((((((((Q9C518_ARATH/44-302,O64647_ARATH/59-280),(Q9SJK7_ARATH/27-186,(Q9LSD5_ARATH/62-246,Q9FLM6_ARATH/52-227))),Q9FTA2_ARATH/15-194),O23875_ORYSA/40-161),Q9M1U4_ARATH/1-165),(((Q9LEZ9_ARATH/17-195,Q9S7W5_ARATH/58-293),Q9LKA2_ARATH/15-280),Q9C758_ARATH/40-241)),(Q9FYG7_ARATH/77-314,Q9XGR9_LINVU/79-321)),Q9FUE7_POPDE/106-351),Q9LII4_ARATH/132-395,Q9CA43_ARATH/74-283);
ATL  16.8712
DNO  17
DLN  807
DID  0.362846
DPH  ((((((((((O64647_ARATH/59-280:0.54017,(O23875_ORYSA/40-161:0.44712,Q9FTA2_ARATH/15-194:0.45463):0.17244):0.04772,Q9SJK7_ARATH/27-186:0.52147):0.15032,Q9C518_ARATH/44-302:0.41828):0.10596,(Q9FLM6_ARATH/52-227:0.56197,Q9LSD5_ARATH/62-246:0.31649):0.20133):0.26449,Q9M1U4_ARATH/1-165:0.51590):0.51082,(Q9C758_ARATH/40-241:0.52104,((Q9LEZ9_ARATH/17-195:0.57155,Q9S7W5_ARATH/58-293:0.47420):0.22855,Q9LKA2_ARATH/15-280:0.62295):0.17788):0.33327):0.07095,Q9XGR9_LINVU/79-321:0.41440):0.16434,Q9FYG7_ARATH/77-314:0.46232):0.24379,Q9CA43_ARATH/74-283:0.37573):0.06652,Q9LII4_ARATH/132-395:0.67876,Q9FUE7_POPDE/106-351:0.43694);
DTP  ((((((((((O64647_ARATH/59-280,(O23875_ORYSA/40-161,Q9FTA2_ARATH/15-194)),Q9SJK7_ARATH/27-186),Q9C518_ARATH/44-302),(Q9FLM6_ARATH/52-227,Q9LSD5_ARATH/62-246)),Q9M1U4_ARATH/1-165),(Q9C758_ARATH/40-241,((Q9LEZ9_ARATH/17-195,Q9S7W5_ARATH/58-293),Q9LKA2_ARATH/15-280))),Q9XGR9_LINVU/79-321),Q9FYG7_ARATH/77-314),Q9CA43_ARATH/74-283),Q9LII4_ARATH/132-395,Q9FUE7_POPDE/106-351);
DTL  11.0242
RID  0.248796
RPH  (((((((((Q9C518_ARATH/44-302:0.73661,O64647_ARATH/59-280:0.80983):0.22773,(Q9SJK7_ARATH/27-186:0.76183,(Q9LSD5_ARATH/62-246:0.67111,Q9FLM6_ARATH/52-227:0.92787):0.22696):0.08601):0.17096,Q9FTA2_ARATH/15-194:0.70529):0.16492,O23875_ORYSA/40-161:0.34286):0.36987,Q9M1U4_ARATH/1-165:0.73514):0.85327,(((Q9LEZ9_ARATH/17-195:0.85109,Q9S7W5_ARATH/58-293:0.67035):0.44633,Q9LKA2_ARATH/15-280:1.02809):0.30605,Q9C758_ARATH/40-241:0.60555):0.69163):0.05657,(Q9FYG7_ARATH/77-314:0.76434,Q9XGR9_LINVU/79-321:0.66423):0.18266):0.26851,Q9FUE7_POPDE/106-351:0.68471):0.24301,Q9LII4_ARATH/132-395:1.24650,Q9CA43_ARATH/74-283:0.36865);
RTP  (((((((((Q9C518_ARATH/44-302,O64647_ARATH/59-280),(Q9SJK7_ARATH/27-186,(Q9LSD5_ARATH/62-246,Q9FLM6_ARATH/52-227))),Q9FTA2_ARATH/15-194),O23875_ORYSA/40-161),Q9M1U4_ARATH/1-165),(((Q9LEZ9_ARATH/17-195,Q9S7W5_ARATH/58-293),Q9LKA2_ARATH/15-280),Q9C758_ARATH/40-241)),(Q9FYG7_ARATH/77-314,Q9XGR9_LINVU/79-321)),Q9FUE7_POPDE/106-351),Q9LII4_ARATH/132-395,Q9CA43_ARATH/74-283);
RTL  16.8712
LNK  O23875_ORYSA/40-161:O23875:D87260
LNK  O64647_ARATH/59-280:O64647:AC003680
LNK  Q9C518_ARATH/44-302:Q9C518:AC079131
LNK  Q9C758_ARATH/40-241:Q9C758:AC073506
LNK  Q9CA43_ARATH/74-283:Q9CA43:AC011914
LNK  Q9FLM6_ARATH/52-227:Q9FLM6:AB010072
LNK  Q9FTA2_ARATH/15-194:Q9FTA2:AL392174
LNK  Q9FUE7_POPDE/106-351:Q9FUE7:AF309094
LNK  Q9FYG7_ARATH/77-314:Q9FYG7:AC002130
LNK  Q9LEZ9_ARATH/17-195:Q9LEZ9:AL357612
LNK  Q9LII4_ARATH/132-395:Q9LII4:AP001303
LNK  Q9LKA2_ARATH/15-280:Q9LKA2:AP000370
LNK  Q9LSD5_ARATH/62-246:Q9LSD5:AB026649
LNK  Q9M1U4_ARATH/1-165:Q9M1U4:AL138649
LNK  Q9S7W5_ARATH/58-293:Q9S7W5:AC011664
LNK  Q9SJK7_ARATH/27-186:Q9SJK7:AC006922
LNK  Q9XGR9_LINVU/79-321:Q9XGR9:AF161252
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9CA43_ARATH/74-283
ASQ  VDGSTSQEVQWRRTVKKRDRHSKICTAQGPRDRRMRLSLQIARKFFDLQDMLGFDKASKTIEWLFSKSKTSIKQLKERVAASEGGGKDEHLQV-----------------.--.--------------------------DEKEKDETLKLRVSKRRTKTMESSFKTKESRERARKRARERTMAKMKMRLFETSETISDP------------HQETREIKITNGVQLLEKENKEQEWSNTNDVHMVEYQMDSVSIIEKFLGLTSDSSSS
DSQ  GTTGATGGAAGCACCTCACAAGAGGTTCAATGGAGAAGGACGGTCAAAAAAAGGGACAGGCATAGTAAGATCTGCACGGCTCAAGGTCCTAGAGACCGGAGGATGAGGCTGTCTCTTCAGATTGCTCGCAAGTTTTTCGATCTTCAAGACATGTTGGGTTTCGACAAGGCGAGCAAGACGATTGAATGGCTTTTCTCCAAATCAAAGACTTCCATCAAACAACTTAAAGAAAGAGTGGCTGCATCGGAAGGAGGAGGAAAGGATGAACATCTCCAGGTT---------------------------------------------------...------...------------------------------------------------------------------------------GATGAAAAGGAAAAGGATGAGACACTGAAGTTGAGAGTCTCAAAGAGAAGAACAAAGACTATGGAGAGCTCTTTTAAGACTAAAGAGTCGAGAGAGAGAGCTAGAAAGCGAGCAAGAGAGAGAACAATGGCAAAGATGAAGATGAGATTATTTGAGACCTCGGAAACAATTTCAGATCCT------------------------------------CATCAAGAAACTAGAGAGATCAAGATAACCAATGGTGTACAATTACTAGAAAAGGAAAATAAAGAACAAGAATGGAGTAATACTAATGATGTTCACATGGTAGAGTATCAAATGGATTCTGTGAGCATCATAGAGAAGTTTCTTGGACTAACCAGTGACTCTAGCTCCTCT
TRN  10010101100011000
NAM  Q9FUE7_POPDE/106-351
ASQ  DTSKQ----PIRQRRTGKDRHSKIHTAQGPRDRRMRLSLQISKKFFDLQDMLGFDKASKTIEWLFTKSKAGIKELTDS--VPGGRRRCSICADGKSVC------------.--.-STPESEVVSGIKLTPETNGDKRGTKAKNDSLVSNPKEKRSKKVHKPVFNLVDRDSREKARARARERTRERMKNQGIDTSSDRSSQANPNKLEKFESSSPLEYGENLAPVNQEMSSPLKVGDVKESSNHDLLPHQMDYVSITGNFFWITNSPRSS
DSQ  GATACTTCAAAGCAG------------CCAATTCGTCAAAGGCGAACCGGGAAGGACAGGCACAGCAAGATCCATACTGCTCAAGGGCCTAGAGATCGAAGGATGAGGTTATCCCTTCAAATTTCCAAAAAGTTCTTTGATCTCCAAGACATGCTCGGCTTCGATAAAGCAAGCAAAACTATTGAGTGGCTCTTTACAAAATCGAAGGCCGGGATCAAGGAGCTCACAGATAGT------GTTCCAGGAGGGAGAAGAAGATGTAGCATTTGTGCTGACGGCAAGAGTGTTTGT------------------------------------...------...---TCCACTCCAGAGAGCGAGGTTGTTTCAGGCATCAAGCTGACACCTGAGACTAACGGGGACAAGAGAGGGACGAAGGCAAAGAATGACTCATTAGTGAGCAATCCTAAAGAGAAAAGGAGCAAGAAAGTGCACAAACCAGTCTTTAATCTTGTTGACAGAGATTCTAGGGAGAAGGCGAGAGCAAGGGCGAGGGAGAGGACAAGAGAGAGGATGAAGAACCAAGGCATAGACACGTCTAGTGATCGGTCTTCTCAGGCAAACCCTAACAAATTGGAAAAGTTTGAGTCTTCTAGCCCCCTCGAATATGGTGAAAATTTGGCTCCTGTAAACCAAGAAATGAGTTCTCCATTGAAGGTTGGTGATGTAAAAGAATCCAGCAATCATGACTTGCTACCACATCAAATGGATTATGTCAGCATCACTGGGAATTTCTTTTGGATCACAAATTCACCAAGATCATCT
TRN  10010101100011000
NAM  Q9XGR9_LINVU/79-321
ASQ  DPANMAETFQTKQSTVKKDRHSKIYTAQGPRDRRVRLSIGIARKFFDLQEMLGFDKPSKTLDWLLTKSKTAIKELVQSKSTKSNSS------------------------.-NsHSDDDCDDEVVSAEGDSENAADSKGKSVLIKGNYKCKEAASAMDSQQAALNLVKESRAKARARARERTKEKMCIKQQLNEARNNNKGGDWINNPFNNVIQSNRNHQQFESREAAFVHHPVFGFHQQNYSNASASSHENWDQSNQLCAILNQHKFI
DSQ  GATCCTGCCAATATGGCAGAAACATTCCAAACCAAACAAAGTACTGTGAAAAAGGACCGGCACAGCAAGATATACACTGCTCAAGGGCCGAGAGACAGGAGAGTTCGTCTGTCCATCGGCATTGCAAGGAAGTTCTTTGATCTACAAGAGATGCTAGGTTTCGACAAGCCAAGCAAGACCCTCGACTGGCTCCTTACTAAGTCGAAAACAGCCATAAAAGAGCTAGTGCAGTCCAAAAGTACGAAGAGCAATTCTTCT------------------------------------------------------------------------...---AATtccCATTCTGATGATGATTGTGATGATGAGGTTGTGTCTGCCGAAGGAGATTCTGAGAACGCTGCAGATTCGAAGGGGAAGTCGGTGCTTATAAAAGGTAACTACAAATGTAAAGAAGCTGCTTCTGCAATGGATTCTCAACAAGCAGCACTCAATCTCGTGAAAGAGTCGAGGGCAAAGGCGAGAGCAAGAGCTAGGGAAAGAACCAAGGAGAAAATGTGTATCAAACAACAACTGAATGAAGCTAGGAACAACAACAAGGGTGGTGACTGGATCAATAATCCCTTCAACAATGTAATCCAGTCTAACAGGAACCATCAACAGTTCGAAAGTCGCGAGGCGGCATTTGTTCATCATCCGGTTTTTGGGTTTCATCAGCAAAACTACAGCAACGCATCTGCCTCCTCTCATGAGAACTGGGATCAGTCGAACCAGCTATGCGCCATTTTGAATCAGCACAAGTTCATC
TRN  10010101100011011
NAM  Q9FYG7_ARATH/77-314
ASQ  EVSK------EIKKVVKKDRHSKIQTAQGIRDRRVRLSIGIARQFFDLQDMLGFDKASKTLDWLLKKSRKAIKEVVQAKNLNNDDEDFGNIGG-----------------.--.-DVEQEEEKEEDDNGDKSFVYGLSPGYGEEEVVCEATKAGIRKKKSELRNISSKGLGAKARGKAKERTKEMMAYDNPETASDITQS---EIMDPFKRSIVFNEGEDMTHLFYKEPIEEFDNQESILTNMTLPTKMGQSYNQNNGILMLVDQSSSS
DSQ  GAGGTGTCAAAG------------------GAAATCAAGAAGGTGGTGAAGAAGGACCGACATAGCAAGATTCAAACGGCACAAGGGATTAGAGACAGGAGGGTTAGGCTTTCTATTGGGATTGCTCGCCAATTCTTTGATCTTCAGGATATGTTGGGGTTTGATAAAGCTAGTAAAACGTTAGACTGGCTGCTCAAGAAGTCAAGAAAAGCCATCAAAGAGGTCGTACAAGCAAAAAACCTCAACAATGATGATGAAGATTTTGGAAACATTGGAGGC---------------------------------------------------...------...---GATGTAGAACAAGAAGAGGAGAAGGAGGAGGATGACAATGGCGATAAGAGCTTCGTGTATGGTTTGAGCCCCGGGTACGGTGAAGAAGAAGTGGTATGTGAGGCCACGAAGGCAGGGATAAGAAAGAAGAAGAGTGAGTTGAGAAACATCTCATCAAAGGGGCTAGGAGCCAAAGCTAGAGGAAAAGCAAAGGAGCGAACAAAAGAGATGATGGCCTATGATAATCCAGAGACTGCCTCTGATATTACACAATCT---------GAAATCATGGACCCATTCAAGAGGTCTATAGTCTTCAATGAAGGAGAAGATATGACACACCTTTTCTACAAGGAACCAATCGAGGAGTTTGATAATCAAGAATCTATCTTAACCAATATGACTCTACCAACGAAGATGGGTCAAAGTTACAATCAAAATAATGGGATACTTATGTTGGTAGATCAGAGTTCTAGCAGC
TRN  10010101100011000
NAM  Q9LII4_ARATH/132-395
ASQ  ISTSQDPKMKKAKKPSRTDRHSKIKTAKGTRDRRMRLSLDVAKELFGLQDMLGFDKASKTVEWLLTQAKPEIIKIATTLSHHGCFSSGDESHIRPVLGSMDTSSDLCELA.--.-SMWTVDDRGSNTNTTDKLSYTLETRGNKVDGRSMRGKRKRPEPRTPILKKLSKEERAKARERAKGRTMEKMMMKMKGRSQLVKVVEEDAHDHGEIIKNNNRSQVNRSSFEMTHCEDKIEELCKNDRFAVCNEFIMNKKDHISNESYDLVNYKPN
DSQ  ATCTCAACTTCTCAAGACCCAAAAATGAAAAAAGCCAAGAAACCCAGCAGAACGGACAGGCACAGCAAGATCAAAACGGCCAAAGGGACACGAGATCGTAGGATGAGACTCTCGCTAGATGTCGCCAAAGAGTTGTTTGGCTTACAAGACATGCTTGGATTTGACAAAGCCAGCAAAACCGTTGAATGGTTGCTTACACAAGCAAAACCTGAGATCATAAAGATCGCGACAACCCTTTCTCACCATGGCTGCTTCAGCAGCGGCGATGAGTCTCATATCCGACCGGTGTTAGGATCCATGGACACATCTTCTGATCTATGTGAACTTGCA...------...---TCCATGTGGACGGTCGACGATAGAGGCAGCAATACTAACACGACCGATAAATTATCTTATACATTAGAAACAAGAGGAAACAAGGTCGATGGGAGATCGATGAGAGGGAAGAGAAAGAGGCCAGAACCGCGAACGCCCATTTTAAAGAAGTTGTCCAAGGAGGAGAGAGCGAAAGCTAGAGAAAGAGCAAAGGGTAGAACAATGGAGAAAATGATGATGAAGATGAAAGGAAGATCACAATTAGTGAAAGTTGTGGAAGAAGACGCTCATGATCATGGTGAGATAATAAAGAATAATAATAGAAGCCAAGTGAATCGGAGTTCTTTTGAGATGACACACTGCGAAGACAAGATCGAAGAACTTTGCAAGAACGATCGTTTTGCAGTTTGCAACGAATTTATCATGAATAAGAAAGATCACATTTCAAATGAATCTTATGACTTAGTCAACTACAAACCGAAC
TRN  10010101110011000
NAM  Q9LKA2_ARATH/15-280
ASQ  GEIVEVQGGHIVRSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDVQDRLGFDRPSKAVDWLIKKAKTSIDELAELPPWNPADAIRLAAANAKPRRTTAKTQISPSPPpP-.-QQQQQQQQLQFGVGFNGGGAEHPSNNESSFLPPSMDSDSIADTIKSFFPVIGSSTEAPSNHNLMHNYHHQHPPDLLSRTNSQNQDLRLSLQSFPDGPPSLLHHQHHHHTSASASEPTLFYGQSNPLGFDTSSWEQQSSEFGRIQRLVAWNSGGG
DSQ  GGCGAGATTGTTGAGGTGCAAGGTGGTCACATTGTTCGGTCTACCGGAAGAAAAGACCGCCACAGCAAAGTCTGCACGGCTAAAGGGCCACGTGACCGGCGCGTGAGACTCTCTGCTCACACGGCGATTCAGTTTTACGATGTTCAAGACAGGCTTGGTTTCGACCGACCTAGCAAAGCCGTTGATTGGCTTATCAAAAAGGCTAAGACTTCCATTGACGAGCTCGCTGAGCTTCCTCCCTGGAATCCCGCCGATGCAATTCGCCTAGCCGCTGCTAACGCTAAACCCAGAAGAACCACCGCCAAAACCCAAATCTCTCCGTCTCCGCCAccgCCG---...---CAACAGCAACAACAACAACAACAGCTTCAGTTCGGTGTTGGCTTCAACGGAGGAGGAGCAGAGCATCCGAGTAACAACGAGTCGAGTTTTCTCCCGCCGTCAATGGATTCAGATTCGATAGCTGACACTATAAAGTCGTTTTTTCCGGTGATTGGCTCTTCAACGGAGGCTCCTTCGAATCATAACCTTATGCACAACTATCATCATCAGCATCCGCCGGATTTGCTTTCTCGAACTAATAGCCAAAACCAAGATCTCCGTCTCTCGCTGCAATCGTTCCCGGATGGTCCACCGTCGCTTCTGCACCACCAACATCACCACCACACCTCTGCTTCCGCCTCCGAGCCTACTCTGTTCTACGGACAGAGCAATCCGTTAGGGTTTGACACATCGAGTTGGGAGCAGCAGTCGTCGGAATTCGGAAGGATTCAGAGACTAGTGGCTTGGAACAGCGGCGGTGGC
TRN  10010101100011000
NAM  Q9S7W5_ARATH/58-293
ASQ  MKSKDPRIVRVSRAFGGKDRHSKVCTLRGLRDRRVRLSVPTAIQLYDLQERLGVDQPSKAVDWLLDAAKEEIDELPPLPISPENFSIFN---------------------.--.--------HHQSFLNLGQRPGQDPTQLGFKINGCVQKSTTTSREENDREKGENDVVYTNNHHVGSYGTYHNLEHHHHHHQHLSLQADYHSHQLHSLVPFPSQILVCPMTTSPTTTTIQSLFPSSSSAGSGTMETLDPRQMVSHFQMPLMGNSSSS
DSQ  ATGAAATCCAAGGATCCGAGGATTGTTAGGGTTTCACGCGCCTTTGGAGGCAAAGACCGTCACAGCAAAGTGTGTACGTTACGTGGACTACGTGACAGACGCGTGAGATTATCAGTCCCAACGGCTATTCAGCTCTACGATCTTCAAGAACGGCTCGGTGTTGACCAGCCTAGCAAAGCCGTTGACTGGTTGCTTGATGCAGCTAAAGAGGAGATCGACGAGCTACCTCCGTTACCTATCTCGCCGGAAAATTTCAGCATCTTCAAC---------------------------------------------------------------...------...------------------------CATCATCAGTCCTTCTTGAATCTTGGTCAACGGCCCGGTCAAGATCCGACCCAACTCGGGTTTAAAATCAATGGATGTGTACAAAAGTCTACTACTACTAGCCGCGAAGAAAACGATAGAGAGAAAGGAGAAAACGATGTCGTTTACACAAACAATCATCATGTTGGGTCTTATGGAACTTATCACAACCTGGAACATCATCATCATCATCACCAACATTTGAGTTTACAGGCAGATTATCATAGTCATCAACTACATAGTCTTGTCCCATTTCCATCACAAATTTTGGTATGTCCAATGACGACATCACCAACAACTACAACTATACAATCTTTGTTTCCATCATCATCGTCAGCTGGTTCAGGGACTATGGAGACATTAGATCCGAGGCAAATGGTAAGCCATTTTCAAATGCCATTAATGGGTAATTCTTCATCTTCG
TRN  10010101100011000
NAM  Q9LEZ9_ARATH/17-195
ASQ  QRWNNPRIVRVSRAFGGKDRHSKVCTVRGLRDRRIRLSVMTAIQVYDLQERLGLSQPSKVIDWLLEVAKNDVDLLPPLQFPPGFHQLN----------------------.--.----------------------------------------------------------------PNLTGLGESFPGVFDLGRTQREALDLEKRKWVNLDHVFDHIDHHNHFSNSIQSNKLYFPTITSSSSSYHYNLGHLQQSLLDQSGNVTVAFS
DSQ  CAACGATGGAATAATCCGAGGATCGTGCGAGTCTCCCGAGCATTTGGAGGCAAAGATAGACACAGCAAAGTGTGCACAGTTCGTGGTCTCCGAGACAGGAGGATAAGGTTGTCGGTGATGACAGCGATCCAAGTCTACGACCTTCAAGAACGATTAGGGCTGAGTCAGCCTAGCAAAGTCATTGATTGGCTCTTAGAAGTTGCCAAAAACGACGTCGATTTGCTTCCTCCTTTGCAATTCCCACCTGGTTTTCACCAACTTAAC------------------------------------------------------------------...------...------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------CCTAATCTCACCGGCCTTGGAGAATCTTTTCCCGGGGTCTTCGATCTTGGAAGAACACAGAGAGAAGCTTTGGATCTTGAGAAAAGGAAATGGGTTAATCTTGATCATGTGTTTGATCACATCGATCATCACAACCATTTCTCGAATTCAATCCAGAGCAACAAGCTTTATTTCCCTACAATTACTTCGTCTAGCAGCTCTTATCACTACAACCTTGGACATCTCCAACAGTCACTACTAGACCAATCTGGTAACGTCACTGTCGCATTTTCT
TRN  10010101100011000
NAM  Q9C758_ARATH/40-241
ASQ  RIIR------VSRASGGKDRHSKVLTSKGLRDRRIRLSVATAIQFYDLQDRLGFDQPSKAVEWLINAASDSITDLPLLNT------------------------------.--.-----------------------NFDHLDQNQNQTKSACSSGTSESSLLSLSRTEIRGKARERARERTAKDRDKDLQNAHSSFTQL----LTGGFDQQPSNRNWTGGSDCFNPVQLQIPNSSSQEPMNHPFSFVPDYNFGISSSSSAINGGYSSR
DSQ  CGTATCATTAGG------------------GTTTCACGAGCTTCTGGTGGCAAAGATAGACATAGCAAAGTGTTAACATCAAAAGGTTTAAGAGATCGAAGAATACGTCTCTCAGTTGCTACAGCAATCCAGTTCTATGATCTTCAAGATCGTCTTGGATTTGATCAGCCAAGTAAAGCTGTTGAATGGTTAATCAATGCAGCTTCTGATTCAATCACTGATCTTCCTTTGCTTAACACA------------------------------------------------------------------------------------------...------...---------------------------------------------------------------------AATTTTGATCATCTTGATCAGAATCAGAATCAGACCAAATCTGCTTGTAGTAGTGGAACATCTGAGAGTTCGCTGTTGTCGTTATCAAGAACAGAGATTCGTGGGAAAGCAAGAGAGAGAGCTAGAGAAAGAACAGCTAAAGACAGAGATAAAGATTTGCAGAATGCTCATAGCTCATTCACTCAGCTT------------CTCACTGGTGGTTTTGACCAACAACCGAGTAACCGGAATTGGACCGGTGGTTCTGATTGCTTTAACCCGGTTCAGCTGCAAATACCAAACTCTTCCTCTCAAGAGCCAATGAATCACCCATTCTCCTTTGTACCTGATTACAACTTTGGAATCTCTTCTTCTTCTTCTGCCATTAATGGTGGTTACAGTAGTAGG
TRN  10010101100011000
NAM  Q9C518_ARATH/44-302
ASQ  LATTSSTATATTTKRSTKDRHTKV----DGRGRRIRMPALCAARVFQLTRELGHKSDGETIEWLLQQAEPAIVAATGTGTIPANFSTLSVSLRSSGSTLSAPPSKSVPL-.--.-YGALGLTHHQYDEQGGGGVFAAHTSPLLGFHHQLQHHQNQNQNQDPVETIPEGENFSRKRYRSVDLSKENDDRKQNENKSLKESETSGPTAAPMWAVAPPSRSGAGNTFWMLPVPTTAGNQMESSSNNNTAAGHRAPPMWPFVNSAGGGAGGGG
DSQ  CTCGCAACAACCTCATCTACGGCAACGGCGACTACAACGAAGCGGTCGACTAAAGACCGTCACACGAAAGTC------------GACGGAAGAGGACGTCGGATTCGTATGCCGGCGCTATGTGCAGCTAGAGTTTTTCAGTTAACGAGAGAGTTAGGTCATAAATCCGATGGTGAAACTATTGAATGGCTTCTTCAACAAGCTGAGCCAGCTATTGTTGCTGCTACAGGTACAGGAACTATTCCGGCGAACTTCTCTACTTTAAGTGTTTCGTTACGAAGTAGTGGATCGACTCTCTCTGCTCCGCCGTCGAAATCGGTGCCGCTT---...------...---TACGGTGCTCTTGGATTGACTCATCATCAGTATGATGAACAAGGAGGCGGCGGTGTGTTTGCTGCTCATACGTCGCCGCTTTTAGGGTTTCATCATCAGCTTCAACACCACCAGAACCAGAATCAGAATCAAGATCCGGTGGAAACTATTCCTGAAGGTGAGAATTTCTCTAGGAAACGGTATAGATCGGTTGATTTGTCTAAAGAAAACGATGATCGGAAACAGAACGAGAATAAATCTTTGAAAGAAAGTGAAACGTCGGGTCCTACGGCGGCGCCGATGTGGGCGGTTGCGCCGCCGAGTAGGTCTGGTGCTGGGAACACTTTTTGGATGCTTCCGGTACCGACAACGGCCGGTAATCAAATGGAGAGTAGTAGCAACAATAACACCGCCGCAGGCCACCGTGCTCCTCCTATGTGGCCATTTGTGAACTCTGCTGGAGGAGGAGCGGGAGGTGGAGGC
TRN  10010101110011000
NAM  Q9LSD5_ARATH/62-246
ASQ  NKKSQNQNQLGPKRSSNKDRHTKV----EGRGRRIRMPALCAARIFQLTRELGHKSDGETIQWLLQQAEPSIIAATGSGTIP--ASA-----------------------.--.---------------------------------------------------LASSAATSNHHQGGSLTAGLMISHDLDGGSSSSGRPLNWGIGGGEGVSRSSLPTGLWPNVAGFGSGVPTTGLMSEGAGYRIGFPGFDFPGVGHMSFASILGGNH
DSQ  AACAAGAAGAGTCAGAATCAGAACCAGCTTGGTCCTAAGAGAAGCTCTAACAAAGACAGACACACTAAAGTC------------GAAGGTAGAGGTCGACGAATTCGGATGCCTGCTCTTTGTGCTGCTAGGATTTTTCAATTGACTAGAGAATTGGGTCATAAATCTGATGGTGAAACTATCCAGTGGCTGCTTCAACAAGCTGAGCCATCGATTATTGCAGCTACTGGTTCAGGAACTATACCG------GCCTCTGCT---------------------------------------------------------------------...------...---------------------------------------------------------------------------------------------------------------------------------------------------------TTAGCTTCTTCAGCTGCAACCTCTAACCATCATCAAGGTGGGTCTCTTACTGCTGGTTTAATGATCAGTCATGACTTAGATGGTGGGTCTAGTAGTAGTGGTAGACCATTAAATTGGGGGATTGGTGGCGGTGAAGGAGTTTCTAGGTCAAGTTTACCAACTGGGTTATGGCCAAATGTAGCTGGGTTTGGTTCTGGTGTGCCAACCACTGGTTTAATGAGTGAAGGAGCTGGTTATAGAATTGGGTTTCCTGGTTTTGATTTTCCTGGTGTTGGTCATATGAGTTTTGCATCTATTTTGGGTGGGAATCAT
TRN  10010101100011000
NAM  Q9FTA2_ARATH/15-194
ASQ  EQTSNKGPLNAVKKPPSKDRHSKV----DGRGRRIRMPIICAARVFQLTRELGHKSDGQTIEWLLRQAEPSIIAATGTGTTP--AS------------------------.--.------------------------------------FSTASLSTSSPF-------------------TLGKRVVRAEEGESGGGGGGGLTVGHTMGTSLMGGGGSGGFWAVPARPDFGQVWSFATGAPPEMVFAQQQQPATLFVRHQQQQQASAA
DSQ  GAGCAGACGTCAAACAAAGGACCTCTTAACGCCGTTAAGAAACCACCGTCTAAAGATCGACACAGCAAAGTT------------GACGGAAGAGGAAGAAGGATTCGTATGCCAATCATTTGCGCAGCTCGAGTTTTTCAATTGACCAGAGAGTTAGGTCACAAGTCCGATGGTCAAACCATAGAGTGGCTTCTCCGTCAAGCTGAGCCTTCTATCATAGCCGCCACTGGAACTGGCACTACTCCG------GCGAGT------------------------------------------------------------------------...------...------------------------------------------------------------------------------------------------------------TTCTCCACTGCTTCTCTCTCCACTTCTTCTCCGTTT---------------------------------------------------------ACTCTCGGGAAACGTGTCGTCAGAGCGGAGGAAGGAGAATCCGGCGGCGGAGGAGGAGGAGGGTTAACAGTGGGACACACAATGGGGACTTCGTTAATGGGTGGTGGTGGTTCTGGTGGGTTTTGGGCTGTTCCGGCGAGGCCGGATTTCGGACAAGTCTGGAGCTTTGCAACCGGAGCTCCACCGGAAATGGTTTTTGCGCAGCAGCAGCAACCAGCTACACTCTTCGTCCGCCACCAGCAGCAACAGCAAGCTTCCGCCGCC
TRN  10010101110011000
NAM  O23875_ORYSA/40-161
ASQ  SDGATPRRVRPRKSPSSSDRHSKV----AGRGRRVRIPAMVAARVFQLTRELGHRTDGETIEWLLRQAEPSIIAATGTGVTP----------------------------.--.---------------------------------------------------------------------------------------------------------------EEAPPAAVAIGSSSVAAAAAAGGHGGAFVHVPYYTALLMQPPNA
DSQ  TCCGACGGCGCCACCCCTCGCCGCGTCAGGCCCAGGAAGTCCCCCTCCTCCTCCGACCGCCACTCCAAGGTC------------GCCGGCCGCGGCCGCCGCGTCCGCATCCCGGCCATGGTGGCCGCCCGCGTCTTCCAGCTCACCCGCGAGCTCGGCCACCGCACCGACGGGGAGACCATCGAGTGGCTACTCCGCCAGGCCGAGCCCTCCATCATCGCCGCCACCGGGACGGGCGTCACCCCG------------------------------------------------------------------------------------...------...---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GAGGAGGCGCCCCCCGCCGCCGTCGCCATCGGCTCTTCCTCGGTCGCCGCCGCCGCCGCCGCCGGCGGGCATGGGGGCGCGTTCGTCCATGTGCCTTACTACACCGCGCTCCTCATGCAGCCGCCTAACGCG
TRN  10010101110011011
NAM  O64647_ARATH/59-280
ASQ  SLAPPSSTGPPLKRASTKDRHTKV----EGRGRRIRMPATCAARIFQLTRELGHKSDGETIRWLLENAEPAIIAATGTGTVPAIAMSVNGTL------------------.--.---------------------KIPTTTNADSDMGENLMKKKRKRPSNSEYIDISDAVSASSGLAPIATTTTIQPPQALASSTVAQQLLPQGMYPMWAIPSNAMIPTVGAFFLIPQIAGPSNQPQLLAFPAAAASPSSYVAAVQQASTMARPPPLQ
DSQ  TCTTTAGCTCCACCGTCTTCGACAGGACCACCATTGAAGAGAGCTTCGACTAAAGACCGTCACACGAAGGTT------------GAAGGAAGAGGGAGAAGGATACGGATGCCTGCCACGTGTGCGGCTAGGATTTTTCAATTAACTCGAGAGTTAGGTCACAAATCCGACGGCGAAACGATTCGGTGGTTGTTGGAGAACGCTGAGCCGGCGATTATAGCCGCCACGGGTACGGGAACGGTTCCCGCCATCGCCATGTCGGTTAACGGAACCTTA------------------------------------------------------...------...---------------------------------------------------------------AAAATCCCGACGACGACGAACGCTGATTCTGATATGGGTGAAAATCTGATGAAGAAGAAACGTAAACGACCTTCTAACAGTGAGTATATAGACATAAGCGACGCCGTTTCAGCTTCCTCCGGTTTAGCTCCAATTGCCACGACGACAACGATCCAACCTCCGCAAGCTCTGGCATCATCCACTGTGGCTCAGCAACTTCTGCCGCAAGGAATGTATCCGATGTGGGCTATTCCATCAAACGCAATGATTCCGACGGTCGGAGCTTTCTTCTTGATTCCACAAATCGCTGGTCCGTCGAATCAGCCTCAGTTATTAGCTTTTCCCGCCGCCGCTGCTTCGCCGTCGTCTTACGTCGCCGCTGTTCAACAGGCTTCCACGATGGCTAGACCACCTCCTTTACAA
TRN  10010101100011000
NAM  Q9SJK7_ARATH/27-186
ASQ  GVSKSSSSGGGCISARTKDRHTKV----NGRSRRVTMPALAAARIFQLTRELGHKTEGETIEWLLSQAEPSIIAATGYGTK-----------------------------.--.------------------------------------------------------------------------LISNWVDVAADDSSSSSSMTSPQTQTQTPQSPSCRLDLCQPIGIQYPVNGYSHMPFTAMLLEPMTTTAESEVEIAEEEERRRR
DSQ  GGTGTTTCGAAATCCTCCTCGAGCGGCGGCGGATGTATCTCCGCCAGGACTAAAGACCGTCACACGAAGGTT------------AACGGACGAAGCCGTCGAGTTACGATGCCGGCTCTCGCCGCCGCTAGGATTTTCCAGTTAACGCGTGAGCTCGGTCACAAAACTGAAGGAGAAACCATCGAATGGCTTCTTAGTCAAGCTGAACCGTCGATTATTGCCGCCACTGGCTACGGGACTAAG---------------------------------------------------------------------------------------...------...------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------CTCATTTCGAATTGGGTTGATGTTGCGGCGGACGATTCCTCGTCGTCGTCGTCGATGACGTCGCCGCAAACGCAAACGCAAACGCCACAATCGCCGAGTTGTAGGTTGGATCTTTGTCAGCCAATCGGAATTCAGTATCCGGTGAATGGTTACAGTCATATGCCGTTCACAGCGATGCTTTTAGAGCCGATGACCACGACGGCGGAATCTGAGGTTGAGATCGCGGAGGAGGAGGAACGTAGACGCCGT
TRN  10010101110011010
NAM  Q9FLM6_ARATH/52-227
ASQ  EDQEIQILYEKEKKKPNKDRHLKV----EGRGRRVRLPPLCAARIYQLTKELGHKSDGETLEWLLQHAEPSILSATVNGIKPTESVVSQ---------------------.--.----------------------------------------------------------------PPLTADLMICHSVEEASRTQMEANGLWRNETGQTIGGFDLNYGIGFDFNGVPEIGFGDNQTPGLELRLSQVGVLNPQVFQQMGKEQFRVLH
DSQ  GAAGACCAAGAAATTCAGATTCTTTATGAGAAGGAGAAGAAGAAACCAAACAAAGATCGTCACCTTAAAGTT------------GAAGGAAGAGGTCGTAGAGTTAGGTTACCTCCACTCTGTGCAGCAAGGATTTATCAATTGACTAAAGAATTAGGTCACAAATCAGATGGTGAGACTCTTGAATGGTTGCTTCAACATGCTGAGCCATCGATACTCTCTGCTACTGTAAATGGTATCAAACCCACTGAGTCTGTTGTTTCTCAA---------------------------------------------------------------...------...------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------CCTCCTCTCACGGCTGATTTGATGATTTGTCATAGCGTTGAAGAAGCTTCAAGGACTCAAATGGAGGCAAATGGGTTGTGGAGAAATGAAACAGGACAGACCATTGGAGGGTTTGATCTGAATTACGGAATTGGGTTTGATTTCAATGGTGTTCCAGAGATTGGTTTTGGAGATAATCAAACGCCTGGACTTGAATTAAGGCTGTCTCAAGTTGGGGTTTTGAATCCACAGGTTTTTCAACAAATGGGTAAAGAACAGTTCAGGGTTCTTCAT
TRN  10010101100011000
NAM  Q9M1U4_ARATH/1-165
ASQ  MDSKNGINNSQKARRTPKDRHLKI----GGRDRRIRIPPSVAPQLFRLTKELGFKTDGETVSWLLQNAEPAIFAATGHGVT-----------------------------.--.-------------------------------------------------------------------TTSNEDIQPNRNFPSYTFNGDNISNNVFPCTVVNTGHRQMVFPVSTMTDHAPSTNYSTISDNYNSTFNGNATASDTTSAATTTATTTV
DSQ  ATGGATTCGAAAAATGGAATTAACAACAGCCAAAAGGCAAGAAGGACTCCAAAAGACCGCCATTTGAAAATT------------GGTGGCCGTGATCGTCGCATTCGGATCCCGCCGAGTGTTGCTCCCCAACTATTTAGATTGACAAAAGAACTCGGCTTTAAAACCGATGGTGAAACTGTCAGTTGGCTCCTCCAGAATGCCGAGCCTGCCATTTTCGCAGCCACGGGACATGGTGTCACC---------------------------------------------------------------------------------------...------...---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ACCACCTCCAATGAAGATATCCAGCCAAATAGGAATTTTCCTAGTTACACCTTTAATGGTGATAATATTAGTAATAACGTTTTCCCTTGTACGGTTGTAAATACTGGTCATCGTCAGATGGTGTTTCCGGTTTCTACAATGACAGATCATGCACCTTCAACTAATTACAGTACTATTAGTGATAATTACAATTCCACCTTTAATGGTAATGCTACCGCCAGTGATACAACATCAGCAGCAACAACAACAGCCACAACCACAGTT
TRN  10010101110011001
//