EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03628 - PapG_C)
FAM  PF03628
PID  PapG_C
DES  PapG chaperone-binding domain
IPR  IPR005309
ANO  3
ALN  109
AID  0.603476
APH  (Q9APE7_ECOLI/228-335:0.25780,Q9AIS9_ECOLI/228-335:0.20602,Q47444_ECOLI/228-336:0.46566);
ATP  (Q9APE7_ECOLI/228-335,Q9AIS9_ECOLI/228-335,Q47444_ECOLI/228-336);
ATL  0.92948
DNO  3
DLN  327
DID  0.640947
DPH  (Q9APE7_ECOLI/228-335:0.21510,Q9AIS9_ECOLI/228-335:0.15269,Q47444_ECOLI/228-336:0.39044);
DTP  (Q9APE7_ECOLI/228-335,Q9AIS9_ECOLI/228-335,Q47444_ECOLI/228-336);
DTL  0.75823
RID  0.603476
RPH  (Q9APE7_ECOLI/228-335:0.25780,Q9AIS9_ECOLI/228-335:0.20602,Q47444_ECOLI/228-336:0.46566);
RTP  (Q9APE7_ECOLI/228-335,Q9AIS9_ECOLI/228-335,Q47444_ECOLI/228-336);
RTL  0.92948
LNK  Q47444_ECOLI/228-336:Q47444:M94076
LNK  Q9AIS9_ECOLI/228-335:Q9AIS9:AF240678
LNK  Q9APE7_ECOLI/228-335:Q9APE7:AF304159
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9APE7_ECOLI/228-335
ASQ  HGNLSIDSAHGNYASQAVTIYCDVPVTVKISLFSNTQPAYNN-QGVAVGLGNGWDSIIYLDGVKRNEETLRWNTAGSRTVTVGSKLYGEAGKITSGALSGSMTMIMHLP
DSQ  CACGGTAATCTTTCTATTGATAGTGCCCATGGTAATTATGCAAGCCAAGCTGTTACCATTTATTGTGACGTCCCGGTTACTGTTAAAATCTCACTATTCAGCAATACACAACCAGCATATAATAAT---CAGGGGGTTGCGGTTGGTTTGGGCAATGGCTGGGATTCAATAATATATCTTGATGGTGTCAAGCGAAATGAGGAAACATTGCGCTGGAATACTGCAGGATCCAGGACAGTGACAGTTGGAAGCAAGTTGTATGGTGAAGCAGGCAAGATAACTTCTGGTGCTTTGTCTGGTTCAATGACGATGATCATGCATCTTCCC
TRN  10010101110011001
NAM  Q9AIS9_ECOLI/228-335
ASQ  HGSIVIDRANGNIASQTLSIYCDVPVSVKISLLRNTPPIYNN-NKFSVGLGNGWDSIISLDGVEQSEEILRWYTAGSKTVKIESRLYGEEGKRKPGELSGSMTMVLSFP
DSQ  CATGGGAGTATTGTGATTGATCGTGCTAACGGAAATATTGCAAGTCAGACGCTTTCAATTTATTGCGATGTACCAGTTAGTGTAAAAATATCTCTGCTCAGAAATACACCACCAATATACAATAAT---AATAAATTTTCGGTTGGGTTAGGTAATGGCTGGGATTCGATAATATCTCTTGATGGGGTTGAACAGAGTGAGGAAATATTACGCTGGTACACAGCCGGCTCAAAAACAGTAAAGATTGAGAGCAGGTTGTATGGTGAAGAGGGAAAGAGAAAACCCGGGGAGCTATCTGGTTCTATGACTATGGTTCTGAGTTTCCCC
TRN  10010101100011000
NAM  Q47444_ECOLI/228-336
ASQ  HGDLSINSANNHYAAQTLSVSCDVPANIRFMLLRNTTPTYSHGKKFSVGLGHGWDSIVSVNGVDTGETTMRWYKAGTQNLTIGSRLYGESSKIQPGVLSGSATLLMILP
DSQ  CATGGTGATCTGTCTATTAATAGCGCTAATAATCATTATGCGGCTCAGACTCTTTCTGTGTCTTGCGATGTGCCTGCAAATATTCGTTTTATGCTGTTAAGAAATACAACTCCGACATACAGCCATGGTAAGAAATTTTCGGTTGGTCTGGGTCATGGCTGGGACTCCATTGTTTCGGTTAACGGGGTAGACACAGGAGAGACAACGATGAGATGGTACAAAGCAGGTACACAAAACCTGACCATCGGCAGTCGCCTCTATGGTGAATCTTCAAAGATACAACCAGGAGTACTATCTGGTTCAGCAACGCTGCTCATGATATTGCCA
TRN  10010101100011000
//