EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03623 - Focal_AT)
FAM  PF03623
PID  Focal_AT
DES  Focal adhesion targeting region
IPR  IPR005189
ANO  3
ALN  139
AID  0.480111
APH  (Q9U531_DROME/945-1083:0.81787,FAK1_CHICK/915-1053:0.21226,FAK2_HUMAN/870-1008:0.38568);
ATP  (Q9U531_DROME/945-1083,FAK1_CHICK/915-1053,FAK2_HUMAN/870-1008);
ATL  1.41581
DNO  3
DLN  417
DID  0.53797
DPH  (Q9U531_DROME/945-1083:0.60125,FAK1_CHICK/915-1053:0.17638,FAK2_HUMAN/870-1008:0.36077);
DTP  (Q9U531_DROME/945-1083,FAK1_CHICK/915-1053,FAK2_HUMAN/870-1008);
DTL  1.1384
RID  0.480111
RPH  (Q9U531_DROME/945-1083:0.81787,FAK1_CHICK/915-1053:0.21226,FAK2_HUMAN/870-1008:0.38568);
RTP  (Q9U531_DROME/945-1083,FAK1_CHICK/915-1053,FAK2_HUMAN/870-1008);
RTL  1.41581
LNK  FAK1_CHICK/915-1053:Q00944:M86656
LNK  FAK2_HUMAN/870-1008:Q14289:U33284
LNK  Q9U531_DROME/945-1083:Q9U531:AF112116
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9U531_DROME/945-1083
ASQ  SRPPNRADDEVYCATTLVVKSIMALSQGVEKANTEGYLELVKNVGVKLRNLLTSVDKISIIFPAQALKEVQMAHQVLSKDMLELVSAMRLAQQYSDTTLDCEYRKSMLSAAHVLAMDAKNLFDVVDSIRQRYQHLFPPS
DSQ  AGTCGACCACCTAACCGCGCAGATGACGAAGTTTATTGCGCCACCACACTGGTGGTCAAATCAATAATGGCGCTGTCACAAGGTGTGGAGAAAGCGAATACCGAGGGTTACTTGGAATTGGTTAAGAACGTGGGCGTCAAGTTGAGAAACTTGCTAACATCGGTGGACAAAATATCTATAATATTTCCAGCACAGGCCCTCAAGGAAGTGCAAATGGCACATCAGGTACTTTCAAAAGACATGCTCGAATTGGTCTCCGCGATGCGTTTGGCTCAACAATATAGTGACACAACGCTGGATTGTGAATATCGCAAGAGTATGCTGTCTGCTGCCCACGTTTTGGCTATGGACGCCAAAAACCTGTTTGATGTCGTCGATTCGATACGTCAACGTTATCAGCATCTATTCCCGCCATCC
TRN  10010101100011001
NAM  FAK1_CHICK/915-1053
ASQ  TANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDESLPVLPASTHREIEMAQKLLNSDLAELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMISQSRPH
DSQ  ACGGCCAACCTGGACCGCTCCAATGACAAAGTCTATGAGAATGTAACCGGGCTGGTGAAAGCTGTCATAGAGATGTCCAGTAAAATACAGCCAGCTCCGCCAGAGGAGTACGTGCCCATGGTAAAGGAGGTTGGCTTGGCGCTGAGAACCTTGCTAGCAACAGTGGATGAGTCGCTGCCAGTGCTTCCTGCAAGCACCCACAGAGAGATTGAGATGGCCCAGAAACTGCTGAACTCTGACCTGGCTGAGCTCATTAACAAGATGAAGCTGGCCCAGCAGTACGTCATGACCAGCCTGCAGCAGGAGTACAAGAAGCAAATGCTGACGGCTGCTCACGCTCTGGCTGTGGATGCCAAGAACTTGCTGGATGTCATCGATCAAGCCAGACTGAAAATGATCAGCCAGTCCAGGCCCCAC
TRN  10010101100011011
NAM  FAK2_HUMAN/870-1008
ASQ  TANLDRTDDLVYLNVMELVRAVLELKNELCQLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAHPPA
DSQ  ACAGCTAACCTGGACCGGACCGATGACCTGGTGTACCTCAATGTCATGGAGCTGGTGCGGGCCGTGCTGGAGCTCAAGAATGAGCTCTGTCAGCTGCCCCCCGAGGGCTACGTGGTGGTGGTGAAGAATGTGGGGCTGACCCTGCGGAAGCTCATCGGGAGCGTGGATGATCTCCTGCCTTCCTTGCCGTCATCTTCACGGACAGAGATCGAGGGCACCCAGAAACTGCTCAACAAAGACCTGGCAGAGCTCATCAACAAGATGCGGCTGGCGCAGCAGAACGCCGTGACCTCCCTGAGTGAGGAGTGCAAGAGGCAGATGCTGACGGCTTCACACACCCTGGCTGTGGACGCCAAGAACCTGCTCGACGCTGTGGACCAGGCCAAGGTTCTGGCCAATCTGGCCCACCCACCTGCA
TRN  10010101100011001
//