EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03622 - IBV_3B)
FAM  PF03622
PID  IBV_3B
DES  IBV 3B protein
IPR  IPR005295
ANO  2
ALN  64
AID  0.783333
APH  (V3B_IBVP3/1-64:0.21719,V3B_IBVB/1-64:0.05774);
ATP  (V3B_IBVP3/1-64,V3B_IBVB/1-64);
ATL  0.27492
DNO  2
DLN  192
DID  0.875
DPH  (V3B_IBVP3/1-64:0.02380,V3B_IBVB/1-64:0.11402);
DTP  (V3B_IBVP3/1-64,V3B_IBVB/1-64);
DTL  0.13782
RID  0.783333
RPH  (V3B_IBVP3/1-64:0.21719,V3B_IBVB/1-64:0.05774);
RTP  (V3B_IBVP3/1-64,V3B_IBVB/1-64);
RTL  0.27492
LNK  V3B_IBVB/1-64:P30241:M95169
LNK  V3B_IBVP3/1-64:P30242:X59819
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  V3B_IBVP3/1-64
ASQ  MLDFAAIIETGQQIIQQISFNLQHISSVLSTELFDPFEVCVYRGGNYWELESADDCSGDDEFIE
DSQ  ATGTTAGATTTTGCAGCAATTATTGAAACTGGTCAGCAAATAATTCAACAAATCAGTTTCAATTTACAGCATATTTCAAGTGTATTGAGCACTGAATTATTTGACCCCTTTGAAGTTTGTGTTTACAGAGGCGGTAATTATTGGGAGTTAGAGTCAGCTGACGATTGTTCAGGTGATGATGAATTTATTGAA
TRN  10010101110011000
NAM  V3B_IBVB/1-64
ASQ  MLNLEVIIETGEQVIQKISFNLQHISSVLNTEVFDPFDYCYYRGGNFWEIESAEDCSGDDEFIE
DSQ  ATGTTAAACTTAGAAGTAATTATTGAAACTGGTGAGCAAGTGATTCAAAAAATCAGTTTCAATTTACAGCATATTTCAAGTGTATTAAACACAGAAGTATTTGATCCCTTTGACTATTGTTATTACAGAGGAGGTAATTTTTGGGAAATAGAGTCAGCTGAAGATTGTTCAGGTGATGATGAATTTATTGAA
TRN  10010101110011000
//