EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03620 - IBV_3C)
FAM  PF03620
PID  IBV_3C
DES  IBV 3C protein
IPR  IPR005296
ANO  2
ALN  93
AID  0.833333
APH  (Q9J4A7_9CORO/1-93:0.11030,VSMP_IBVP3/1-93:0.08861);
ATP  (Q9J4A7_9CORO/1-93,VSMP_IBVP3/1-93);
ATL  0.19891
DNO  2
DLN  279
DID  0.874552
DPH  (Q9J4A7_9CORO/1-93:0.13377,VSMP_IBVP3/1-93:0.00662);
DTP  (Q9J4A7_9CORO/1-93,VSMP_IBVP3/1-93);
DTL  0.14039
RID  0.833333
RPH  (Q9J4A7_9CORO/1-93:0.09436,VSMP_IBVP3/1-93:0.10455);
RTP  (Q9J4A7_9CORO/1-93,VSMP_IBVP3/1-93);
RTL  0.19891
LNK  Q9J4A7_9CORO/1-93:Q9J4A7:AF203003
LNK  VSMP_IBVP3/1-93:P30246:X59819
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9J4A7_9CORO/1-93
ASQ  MMNLLNKSLEENGSFLTALYIFVGFLAFYLLGRALQAFVQAADACCLFWYTWLVIPGVKGTAFVYKYTYGRKLNNSELEAVVVNEFPKNGWNN
DSQ  ATGATGAATTTATTGAATAAGTCGCTAGAGGAGAATGGAAGTTTTCTAACAGCGCTTTACATATTTGTAGGATTTTTAGCATTTTATCTTCTAGGTAGAGCACTTCAAGCATTTGTACAGGCTGCTGATGCTTGTTGTTTATTTTGGTATACATGGTTAGTAATTCCAGGAGTTAAGGGTACAGCCTTTGTATACAAGTATACATATGGTAGAAAACTTAACAATTCGGAATTAGAAGCAGTTGTTGTTAACGAGTTTCCTAAGAACGGTTGGAATAAT
TRN  10010101110011010
NAM  VSMP_IBVP3/1-93
ASQ  MMNLLNKSLEENGSVLTAFYIFVAFVALYLLGRALQAFVQAADACCLFWYTWVVVPGAKGTTFVYKHTYGKKLNKPELETVIVNEFPKNGWKQ
DSQ  ATGATGAATTTATTGAATAAATCACTAGAGGAGAACGGAAGTGTCCTAACAGCATTTTATATATTTGTTGCATTTGTAGCACTTTACCTATTAGGTAGAGCACTCCAAGCATTTGTACAAGCTGCTGATGCTTGTTGTTTATTTTGGTATACATGGGTAGTAGTTCCTGGAGCTAAGGGTACAACCTTTGTGTATAAGCATACATATGGTAAAAAACTTAACAAACCGGAGTTAGAAACGGTTATTGTTAACGAGTTTCCTAAGAACGGTTGGAAACAA
TRN  10010101110011000
//