EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03615 - GCM)
FAM  PF03615
PID  GCM
DES  GCM motif protein
IPR  IPR003902
ANO  4
ALN  106
AID  0.639611
APH  ((GCM_DROME/34-137:0.24966,GCM2_DROME/74-179:0.10231):0.28647,GCM1_HUMAN/16-118:0.31450,GCM2_MOUSE/21-123:0.16851);
ATP  ((GCM_DROME/34-137,GCM2_DROME/74-179),GCM1_HUMAN/16-118,GCM2_MOUSE/21-123);
ATL  1.12145
DNO  4
DLN  318
DID  0.657208
DPH  ((GCM_DROME/34-137:10.80664,GCM2_DROME/74-179:11.07336):12.64737,GCM1_HUMAN/16-118:8.81531,GCM2_MOUSE/21-123:13.65899);
DTP  ((GCM_DROME/34-137,GCM2_DROME/74-179),GCM1_HUMAN/16-118,GCM2_MOUSE/21-123);
DTL  57.0028
RID  0.639611
RPH  ((GCM_DROME/34-137:0.24966,GCM2_DROME/74-179:0.10231):0.28647,GCM1_HUMAN/16-118:0.31450,GCM2_MOUSE/21-123:0.16851);
RTP  ((GCM_DROME/34-137,GCM2_DROME/74-179),GCM1_HUMAN/16-118,GCM2_MOUSE/21-123);
RTL  1.12145
LNK  GCM1_HUMAN/16-118:Q9NP62:D88613
LNK  GCM2_DROME/74-179:Q9VLA2:AF184664
LNK  GCM2_MOUSE/21-123:O09102:D88611
LNK  GCM_DROME/34-137:Q27403:D64040
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  GCM2_MOUSE/21-123
ASQ  WDINDPQMPQEP-THFDHFREWPDGYVRFIYSSQEKKAQRHLSGWAMRNTNNHNGHILKKSCLGVVVCARACALKDGSHLQLRPAICDKARLKQQKKACPN--CHS
DSQ  TGGGACATCAATGACCCACAGATGCCTCAGGAACCA---ACCCACTTTGACCACTTCCGGGAGTGGCCTGATGGCTACGTGCGCTTCATCTACAGCAGCCAGGAGAAGAAGGCTCAGCGCCACCTGAGTGGCTGGGCCATGCGCAACACCAACAACCACAATGGCCACATCCTCAAGAAGTCCTGCCTGGGCGTGGTGGTGTGCGCACGCGCTTGCGCCCTGAAGGATGGCTCGCACCTGCAGCTGAGGCCAGCCATCTGTGACAAGGCCCGGCTGAAGCAACAAAAGAAAGCTTGCCCCAAC------TGTCACTCG
TRN  10010101100011011
NAM  GCM1_HUMAN/16-118
ASQ  WDINDVKLPQNV-KKTDWFQEWPDSYAKHIYSSEDKNAQRHLSSWAMRNTNNHNSRILKKSCLGVVVCGRDCLAEEGRKIYLRPAICDKARQKQQRKRCPN--CDG
DSQ  TGGGATATTAATGATGTGAAACTGCCACAGAACGTG---AAAAAAACCGACTGGTTCCAGGAGTGGCCAGATTCCTATGCCAAACACATCTACAGCTCGGAGGACAAGAATGCGCAGCGGCACCTGAGCAGCTGGGCCATGCGCAATACCAACAACCACAACTCCCGCATCCTCAAGAAGTCCTGCCTGGGTGTGGTGGTGTGCGGCCGCGACTGTCTCGCAGAGGAGGGGCGCAAGATCTACCTGAGACCTGCCATCTGTGACAAGGCCCGGCAGAAGCAGCAGCGGAAACGCTGTCCCAAC------TGTGACGGG
TRN  10010101100011011
NAM  GCM_DROME/34-137
ASQ  WDINDSKMPSVG--EFDDFNDWSNGHCRLIYSVQSDEARKHASGWAMRNTNNHNVNILKKSCLGVLLCSAKCKLPNGASVHLRPAICDKARRKQQGKQCPNRNCNG
DSQ  TGGGACATCAACGATTCCAAGATGCCGTCGGTGGGG------GAGTTTGACGATTTCAATGACTGGTCCAACGGACATTGCCGGCTCATCTACTCCGTGCAGAGTGATGAGGCCAGGAAACATGCCAGCGGTTGGGCCATGCGAAACACCAACAACCACAACGTGAATATCCTAAAGAAGAGCTGCCTGGGAGTGCTCCTCTGCAGTGCCAAGTGCAAGTTGCCCAATGGAGCCAGTGTGCATCTGAGACCCGCCATTTGCGACAAGGCCAGAAGGAAGCAGCAGGGCAAACAGTGTCCCAATAGAAATTGCAATGGT
TRN  10010101100011011
NAM  GCM2_DROME/74-179
ASQ  WDINDAIVPHVPDQEFDEFNEWSDGHVRHIYSLHNEEAKKHISGWAMRNTNNHNVNILKKSCLGVLVCSQHCTLPNGSKINLRPAICDKARRKQEGKACPNKSCRG
DSQ  TGGGACATCAATGATGCCATTGTGCCACATGTGCCGGACCAGGAGTTCGACGAGTTCAACGAGTGGAGCGACGGGCATGTGAGGCACATCTATTCGCTGCACAACGAGGAGGCCAAGAAGCACATTTCCGGCTGGGCCATGCGCAACACGAACAACCACAACGTGAACATTCTGAAGAAGAGCTGCCTGGGCGTCCTGGTCTGCTCCCAACACTGCACCCTGCCCAACGGATCCAAGATCAACCTGCGCCCAGCCATTTGCGACAAAGCCCGGCGGAAGCAGGAGGGCAAGGCGTGTCCCAACAAAAGTTGTCGTGGC
TRN  10010101100011011
//