EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03596 - Cad)
FAM  PF03596
PID  Cad
DES  Cadmium resistance transporter
IPR  IPR004676
ANO  6
ALN  195
AID  0.429979
APH  ((((Q9JXN6_NEIMB/16-206:0.42527,P95773_STALU/16-207:0.25301):0.16605,Q9CE92_LACLA/15-205:0.60660):0.39116,Q97PJ0_STRPN/12-204:0.41435):0.23353,Q53650_STAAU/26-217:0.30227,Q45153_BACFI/12-194:0.49906);
ATP  ((((Q9JXN6_NEIMB/16-206,P95773_STALU/16-207),Q9CE92_LACLA/15-205),Q97PJ0_STRPN/12-204),Q53650_STAAU/26-217,Q45153_BACFI/12-194);
ATL  3.2913
DNO  6
DLN  585
DID  0.529666
DPH  ((((Q9CE92_LACLA/15-205:0.44802,Q9JXN6_NEIMB/16-206:0.25798):0.04810,P95773_STALU/16-207:0.24753):0.24803,Q97PJ0_STRPN/12-204:0.31482):0.14247,Q45153_BACFI/12-194:0.35304,Q53650_STAAU/26-217:0.30892);
DTP  ((((Q9CE92_LACLA/15-205,Q9JXN6_NEIMB/16-206),P95773_STALU/16-207),Q97PJ0_STRPN/12-204),Q45153_BACFI/12-194,Q53650_STAAU/26-217);
DTL  2.36891
RID  0.429979
RPH  ((((Q9JXN6_NEIMB/16-206:0.42527,P95773_STALU/16-207:0.25301):0.16605,Q9CE92_LACLA/15-205:0.60660):0.39116,Q97PJ0_STRPN/12-204:0.41435):0.23353,Q53650_STAAU/26-217:0.30227,Q45153_BACFI/12-194:0.49906);
RTP  ((((Q9JXN6_NEIMB/16-206,P95773_STALU/16-207),Q9CE92_LACLA/15-205),Q97PJ0_STRPN/12-204),Q53650_STAAU/26-217,Q45153_BACFI/12-194);
RTL  3.2913
LNK  P95773_STALU/16-207:P95773:U74623
LNK  Q45153_BACFI/12-194:Q45153:Z17326
LNK  Q53650_STAAU/26-217:Q53650:L10909
LNK  Q97PJ0_STRPN/12-204:Q97PJ0:AE007456
LNK  Q9CE92_LACLA/15-205:Q9CE92:AE006425
LNK  Q9JXN6_NEIMB/16-206:Q9JXN6:AE002544
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q97PJ0_STRPN/12-204
ASQ  YISTSIDYLIILIILFAQLSQNKQKWHIYAGQYLGTGLLVGASLVAAYVVN-FVPEEWMVGLLGLIPIYLGIRFAIVGEDAEEEEEEIIERLEQSKANQLFWTVTLLTIAS-GGDNLGIYIPYFASLDWSQTLVALLVFVIGIIIFCEISRVLSSIPLIFETIEKYERIIVPLVFILLGLYIMYENGTIETFLIV
DSQ  TATATTTCCACCAGTATCGATTATTTAATTATTTTAATTATTTTATTTGCACAGCTATCACAGAATAAACAGAAATGGCATATTTATGCGGGGCAATATCTAGGCACAGGCTTACTTGTAGGGGCGAGTTTAGTTGCTGCTTATGTCGTTAAT---TTCGTGCCTGAAGAATGGATGGTTGGATTGCTTGGTTTAATCCCTATCTATTTAGGGATTCGCTTTGCAATTGTTGGAGAAGATGCGGAAGAAGAAGAGGAAGAAATTATTGAAAGATTAGAACAAAGCAAGGCAAATCAACTGTTTTGGACAGTTACATTGCTGACAATTGCGTCT---GGCGGAGATAATTTAGGTATCTATATACCTTATTTTGCTTCGTTAGATTGGTCACAGACCCTCGTGGCCTTGCTTGTGTTTGTAATCGGCATAATTATCTTTTGCGAGATTAGTCGGGTGTTATCCTCTATTCCGTTAATATTCGAGACAATTGAAAAATACGAGCGAATCATTGTGCCCTTAGTATTCATTCTACTTGGACTATACATCATGTATGAAAATGGCACGATAGAGACTTTTCTGATCGTG
TRN  10010101100011000
NAM  Q53650_STAAU/26-217
ASQ  YVATGIDYLVILILLFSQVKKG-QVKHIWIGQYIGTAIVIGASLLVAQGVVNLIPQQWVIGLLGLLPLYLGVKIWIKGEE-DEDESSILSLFSSGKFNQLFLTMIFIVLAS-SADDFSIYIPYFTTLSMSEIFIVTIVFLIMVGVLCYVSYRLASFDFISETIEKYERWIVPIVFIGLGIYILFENGTSNALISF
DSQ  TATGTAGCAACAGGAATTGATTATCTCGTCATATTAATTCTTTTGTTTTCGCAAGTAAAAAAAGGT---CAGGTAAAACATATTTGGATAGGACAATATATAGGGACTGCAATTGTGATAGGAGCAAGTCTTTTAGTTGCACAGGGGGTTGTAAATTTAATTCCTCAGCAATGGGTTATCGGACTACTTGGACTTTTACCACTTTACCTAGGCGTGAAAATATGGATTAAAGGAGAAGAG---GATGAAGATGAAAGTAGCATTTTATCTTTATTCTCCTCTGGAAAATTTAATCAGTTATTTTTGACGATGATTTTCATCGTATTGGCTTCC---AGTGCGGATGACTTTTCCATTTATATACCGTACTTCACGACCTTAAGTATGTCTGAAATCTTTATTGTCACTATTGTCTTTCTAATTATGGTTGGAGTTTTGTGCTATGTCAGTTACCGTCTAGCTTCCTTCGATTTTATATCGGAAACAATTGAGAAATATGAACGTTGGATTGTACCAATTGTATTCATTGGGCTAGGTATTTATATATTGTTTGAAAATGGAACATCCAATGCTCTGATTTCATTT
TRN  10010101100011000
NAM  Q45153_BACFI/12-194
ASQ  KTSEGLK------GNQTENKHI-SPKDIIIGQYLGFTLLVVVSLLGTFGVM-LIPEKWV-GLLGLIPIYLGIMLFIKGE--DEDENAILSSLNSGKYNSVFLSVAFITFAN-GGDNIGIYVPFFSTLTMNQLAVTVITFFIMVAIWCFIGYRLAAFKHVSETLENYGRWIIPIVFIGLGIYIMVENETFSALLSL
DSQ  AAAACGAGTGAAGGTTTAAAA------------------GGTAACCAGACAGAGAATAAGCATATA---TCCCCTAAGGATATAATTATTGGACAATATCTAGGTTTTACCTTGTTAGTAGTAGTTAGTCTCTTAGGAACTTTTGGAGTTATG---TTAATTCCAGAGAAATGGGTA---GGATTACTTGGACTAATCCCAATCTATTTAGGGATTATGTTGTTTATAAAGGGAGAA------GATGAGGATGAAAATGCAATTCTTTCAAGTTTAAATTCTGGAAAGTATAATAGTGTCTTTTTAAGTGTAGCATTTATAACATTTGCTAAT---GGCGGAGATAACATTGGAATATATGTTCCTTTCTTCTCTACTTTAACCATGAACCAACTAGCAGTAACGGTTATTACTTTCTTTATTATGGTTGCGATTTGGTGTTTTATTGGATATCGTTTGGCAGCTTTTAAACATGTCTCTGAAACCTTAGAGAATTACGGTAGATGGATTATACCCATTGTCTTTATTGGTTTAGGAATCTATATCATGGTGGAGAACGAAACTTTCAGTGCCCTTTTGAGTTTA
TRN  10010101110011000
NAM  Q9CE92_LACLA/15-205
ASQ  YWATALDLLILLAILYVRFD-KKSHLSITLGQIIGSFALVLVSLFFAVILK-LVPEEWILGLLGLIPLGLGIKYLFFGD--DDDDEELDELLQKRKNKSLLGTVIIISFASCGADNIALFTPFFMTLSANNLLLSIIIFALNILILGLLGKTIAKIPHLHDVLEKYSRWILAFVYIVLGIMVLLESGTVSKILSF
DSQ  TACTGGGCAACAGCCCTAGATTTACTTATATTACTAGCAATATTATATGTTCGTTTTGAT---AAAAAAAGTCATTTATCTATTACTTTGGGACAAATAATTGGTTCTTTTGCACTTGTATTGGTCAGTTTATTTTTTGCGGTCATCCTAAAA---CTTGTTCCAGAAGAGTGGATTTTAGGCTTACTGGGCCTGATTCCTTTAGGACTAGGAATAAAATATTTATTCTTTGGGGAT------GATGATGACGATGAAGAATTAGATGAATTGCTACAAAAAAGGAAAAATAAAAGCTTGCTTGGAACTGTTATTATCATTTCTTTTGCGAGTTGTGGAGCGGATAATATTGCTTTGTTTACTCCATTTTTTATGACACTGTCAGCTAATAATTTGCTATTATCTATAATAATTTTTGCCTTAAACATATTAATTTTAGGGCTTCTTGGAAAAACAATTGCAAAAATTCCTCACCTTCATGACGTTTTAGAAAAATACAGTCGTTGGATTCTTGCTTTTGTTTATATAGTACTTGGAATAATGGTTTTACTAGAAAGTGGAACAGTCTCCAAAATTCTCAGTTTT
TRN  10010101100011000
NAM  P95773_STALU/16-207
ASQ  YIAQALDLLVILLMFFARAKTRKEYRDIYIGQYVGSVALIVISLFFAFVLN-YVPEKWILGLLGLIPIYLGIKVAIYGD--SDGEERAKKELNEKGLSKLVGTIAIVTIASCGADNIGLFVPYFVTLSVTNLLITLFVFLILIFFLVFAAQKLANIPEVGEIVEKFGRWIMAVIYIALGLFIIIENDTIQTILGF
DSQ  TATATTGCGCAAGCATTAGACTTATTAGTGATTTTATTAATGTTCTTTGCTAGAGCAAAGACTAGGAAAGAATATCGAGATATTTATATTGGTCAATATGTAGGATCTGTGGCATTAATTGTCATAAGTTTATTCTTTGCCTTTGTCTTAAAT---TATGTTCCTGAAAAATGGATATTAGGATTATTAGGGTTAATACCGATTTATTTAGGAATTAAAGTGGCTATTTATGGTGAT------AGTGACGGAGAAGAGAGAGCTAAAAAAGAATTGAATGAAAAGGGATTGTCTAAATTAGTTGGTACGATTGCAATTGTTACGATAGCAAGTTGTGGTGCCGATAATATTGGTTTATTTGTTCCGTATTTTGTGACATTAAGTGTTACTAATTTATTAATTACTTTGTTTGTCTTTTTAATTTTAATTTTCTTCTTGGTATTTGCTGCACAAAAATTAGCTAATATTCCAGAGGTTGGAGAAATTGTTGAGAAATTTGGTCGTTGGATTATGGCTGTTATTTATATAGCTTTAGGTTTATTTATCATTATAGAAAATGACACTATTCAAACGATTTTAGGATTT
TRN  10010101110011010
NAM  Q9JXN6_NEIMB/16-206
ASQ  YSGTAVDLLIILMLFFAKRKSRKDIINIYLGQFLGSVSLILLSLLFAFVLD-YIPSKEILGLLGLIPILLGIKVLLLGD--SDGEAIAKEGLR-KDNKNLIFLVAMITFASCGADNIGVFVPYFTTLNLANLIVALLTFLVMIYLLVFSAQKLAQVPSVGETLEKYSRWFVAVVYLGLGIYILVENNSFDMLWTV
DSQ  TATTCTGGGACAGCCGTAGACTTACTTATTATCCTAATGTTATTTTTTGCCAAAAGAAAAAGTAGAAAAGACATCATTAACATCTATTTAGGACAATTTCTAGGCTCTGTTAGTCTGATATTGCTAAGTTTACTTTTTGCATTTGTCTTAGAT---TATATTCCTAGTAAAGAGATTTTAGGTTTGCTCGGCTTGATTCCAATTCTCCTAGGCATCAAAGTTTTGCTTTTAGGAGAT------TCTGATGGAGAGGCTATTGCCAAAGAGGGTTTGCGC---AAAGATAATAAAAACCTGATTTTTCTAGTCGCTATGATTACTTTTGCAAGTTGTGGTGCTGACAATATTGGTGTCTTTGTCCCATATTTTACTACCTTAAATTTAGCGAATTTGATAGTGGCTTTACTTACCTTTCTAGTCATGATTTATCTCTTGGTTTTTTCTGCCCAAAAATTAGCACAAGTCCCTTCTGTTGGAGAAACTTTGGAAAAATATAGCAGATGGTTTGTTGCTGTTGTTTATTTAGGATTGGGGATATATATCCTGGTTGAAAACAACAGTTTTGATATGCTATGGACTGTG
TRN  10010101100011010
//