EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03594 - BenE)
FAM  PF03594
PID  BenE
DES  Benzoate membrane transport protein
IPR  IPR004711
ANO  9
ALN  395
AID  0.3902
APH  (((Q9L7Y0_PSEPU/6-383:0.42662,(Q9RUP7_DEIRA/156-540:0.76484,Q9RY94_DEIRA/39-426:0.61210):0.14055):0.06251,(((Q9KQM8_VIBCH/4-381:0.67987,Q98CP3_RHILO/1-376:0.60316):0.11624,YDCO_ECOLI/5-381:0.51107):0.10038,Q9I374_PSEAE/15-392:0.34883):0.13469):0.25762,BENE_ACIAD/10-387:0.29227,Q9AQS9_9BURK/16-393:0.35757);
ATP  (((Q9L7Y0_PSEPU/6-383,(Q9RUP7_DEIRA/156-540,Q9RY94_DEIRA/39-426)),(((Q9KQM8_VIBCH/4-381,Q98CP3_RHILO/1-376),YDCO_ECOLI/5-381),Q9I374_PSEAE/15-392)),BENE_ACIAD/10-387,Q9AQS9_9BURK/16-393);
ATL  5.42165
DNO  8
DLN  1185
DID  0.502531
DPH  (((Q9I374_PSEAE/15-392:0.27532,(Q9RY94_DEIRA/39-426:0.44997,Q9L7Y0_PSEPU/6-383:0.30327):0.06549):0.03819,(Q9RUP7_DEIRA/156-540:0.45942,(Q9KQM8_VIBCH/4-381:0.56665,Q98CP3_RHILO/1-376:0.33310):0.05698):0.07957):0.16297,BENE_ACIAD/10-387:0.45060,Q9AQS9_9BURK/16-393:0.25043);
DTP  (((Q9I374_PSEAE/15-392,(Q9RY94_DEIRA/39-426,Q9L7Y0_PSEPU/6-383)),(Q9RUP7_DEIRA/156-540,(Q9KQM8_VIBCH/4-381,Q98CP3_RHILO/1-376))),BENE_ACIAD/10-387,Q9AQS9_9BURK/16-393);
DTL  3.48954
RID  0.390278
RPH  (Q9RY94_DEIRA/39-426:0.61409,((Q9KQM8_VIBCH/4-381:0.71046,Q98CP3_RHILO/1-376:0.57206):0.12572,((Q9L7Y0_PSEPU/6-383:0.43213,(BENE_ACIAD/10-387:0.29595,Q9AQS9_9BURK/16-393:0.35188):0.24482):0.09961,Q9I374_PSEAE/15-392:0.39113):0.12250):0.11315,Q9RUP7_DEIRA/156-540:0.75407);
RTP  (Q9RY94_DEIRA/39-426,((Q9KQM8_VIBCH/4-381,Q98CP3_RHILO/1-376),((Q9L7Y0_PSEPU/6-383,(BENE_ACIAD/10-387,Q9AQS9_9BURK/16-393)),Q9I374_PSEAE/15-392)),Q9RUP7_DEIRA/156-540);
RTL  4.82757
LNK  BENE_ACIAD/10-387:P07775:AF009224
LNK  Q98CP3_RHILO/1-376:Q98CP3:BA000012
LNK  Q9AQS9_9BURK/16-393:Q9AQS9:AB024746
LNK  Q9I374_PSEAE/15-392:Q9I374:AE004593
LNK  Q9KQM8_VIBCH/4-381:Q9KQM8:AE004272
LNK  Q9L7Y0_PSEPU/6-383:Q9L7Y0:AF218267
LNK  Q9RUP7_DEIRA/156-540:Q9RUP7:AE001980
LNK  Q9RY94_DEIRA/39-426:Q9RY94:AE001868
LNK  YDCO_ECOLI/5-381:P76103:
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9AQS9_9BURK/16-393
ASQ  GNWSVSAVSAG-LLAVIISYAGPLAIFFQAA---HTAHVGNDVIASWVWSISMGAAVSGIALSWWLKQPIITAWSAPGTALLVTLFPGMPVSEAIGAYIVAGACIFALGLSGWFDQIVKRIPKGIACAMMAGILFQFGVNVFKAVALTPWLALGMLASFLVFRRWAPRYCLILVLAFGGALAVGLGLTHFESVSL--HLTRPVFTMPTWTWQSTVSLAVPLVIVSLTGQFLPGFAILRASGY-QTPTRPVLMTTSLASMLVAFSGGITIVIAAITAALCTGPDAHRDPQRRYVAGIANGLFYLAGGCFAGTVVMLFAALPNAFVAVLAGLALLGAIAANIVGLVQDEAHRE----------ASFITFIATASNMSFLGLGSAFWGIVLGTVAHLV
DSQ  GGTAACTGGTCCGTGTCGGCGGTGAGCGCCGGG---CTGCTCGCCGTCATCATCTCGTATGCGGGACCGCTCGCGATCTTCTTTCAGGCCGCG---------CACACGGCGCATGTCGGCAACGACGTGATCGCATCGTGGGTCTGGTCGATCTCGATGGGCGCGGCGGTCTCGGGCATCGCGCTGAGCTGGTGGCTGAAGCAGCCGATCATCACGGCGTGGTCCGCACCGGGCACGGCCCTGCTCGTCACGCTGTTTCCCGGCATGCCGGTGAGCGAAGCGATCGGCGCGTATATCGTCGCGGGCGCATGCATCTTTGCGCTGGGCCTTTCCGGCTGGTTCGATCAGATCGTCAAGCGCATCCCGAAAGGCATCGCCTGCGCGATGATGGCGGGCATCCTGTTTCAGTTCGGCGTCAACGTATTCAAGGCGGTGGCGCTCACGCCGTGGCTCGCTCTGGGAATGCTCGCGAGCTTCCTCGTGTTCCGCCGATGGGCGCCGCGCTACTGTCTCATTCTGGTGCTGGCGTTCGGCGGCGCGCTTGCCGTCGGGCTCGGCCTGACGCATTTCGAATCGGTCAGTCTG------CACCTCACGCGCCCTGTCTTCACCATGCCGACCTGGACGTGGCAATCCACCGTGAGTCTCGCGGTGCCGCTCGTCATCGTGAGCCTGACGGGACAGTTCCTGCCGGGCTTCGCCATCCTGCGCGCGTCCGGCTAT---CAGACGCCGACGCGCCCGGTCCTCATGACGACGAGTCTCGCGTCGATGCTGGTCGCGTTCTCGGGCGGCATCACGATCGTCATCGCGGCGATCACCGCGGCGCTGTGCACCGGTCCCGACGCGCATCGCGATCCGCAGCGCCGCTACGTCGCGGGCATCGCGAACGGGCTTTTCTATCTGGCGGGCGGATGCTTCGCCGGAACCGTCGTGATGCTGTTCGCCGCGCTGCCGAACGCCTTCGTCGCGGTGCTCGCCGGGCTCGCATTGCTGGGCGCGATCGCGGCCAACATCGTCGGACTGGTGCAGGACGAGGCGCATCGCGAG------------------------------GCGTCGTTCATCACGTTCATCGCGACGGCCTCCAACATGAGCTTTCTCGGGCTCGGCTCGGCGTTCTGGGGCATCGTGCTCGGAACCGTGGCGCATCTGGTG
TRN  11011101101011011
NAM  BENE_ACIAD/10-387
ASQ  QDWSLSATIAG-FLAVLISYSGPLIIFFQAA---QKAHVSTEMMISWIWAISIGAAVTGIFLSIRFKTPVVTAWSAPGTALLVTLFPNISLNEAVAAYITAAIVIFLVGITGYFDKLLKWIPQGIAAGMMAGILFQFGLGLFLATDTLPLIVFSMLLCYLISRRFSPRYCMLWVLICGVAFSFFLGKMNPVPLDF--QIARPQFIAPEWSWFSTLNLALPLILVSLTGQFLPGMAILKLSGY-NTPAKPIIAAASLASLFAAFAGGITIVLASITATLCMGKDAHELKDKRYIAGIANGLFYVLGGVFAGSIVALFSLLPKELVAALAGLALLGAIASNIKIAMQEDQQRD----------PALITFLATVSGMHFLGLSSVFWGMCIGMLAYFI
DSQ  CAAGATTGGTCGTTATCGGCCACGATTGCAGGC---TTTTTAGCGGTCCTGATTTCATACTCGGGCCCGTTAATTATCTTCTTTCAGGCGGCA---------CAAAAAGCACATGTCTCGACAGAGATGATGATCTCTTGGATTTGGGCTATTTCGATCGGTGCCGCCGTGACAGGTATTTTTTTATCTATTCGGTTTAAAACACCTGTAGTGACCGCGTGGTCGGCACCCGGGACAGCATTGTTGGTTACTTTGTTTCCCAACATTAGTTTAAATGAAGCCGTTGCCGCTTATATTACCGCGGCAATTGTGATTTTTCTGGTCGGCATTACCGGCTATTTTGACAAACTACTCAAATGGATACCGCAGGGAATTGCTGCTGGCATGATGGCCGGCATTTTATTCCAGTTTGGTCTTGGGCTATTTCTTGCCACCGATACTTTACCGCTGATCGTGTTTAGCATGTTGCTGTGTTATCTGATCAGTCGACGCTTTTCACCACGTTACTGCATGCTTTGGGTACTTATTTGTGGTGTAGCGTTTAGTTTTTTTCTTGGAAAAATGAATCCGGTGCCGCTAGATTTT------CAAATTGCACGCCCGCAGTTTATTGCACCAGAGTGGTCATGGTTTTCAACCTTAAATTTGGCGCTGCCGCTAATTTTGGTGAGCTTAACAGGGCAGTTTCTGCCTGGTATGGCCATTTTAAAACTCAGTGGGTAT---AACACACCCGCCAAACCAATTATTGCCGCCGCAAGCTTGGCCTCGTTGTTTGCTGCCTTTGCAGGTGGAATTACCATTGTACTGGCCTCCATTACAGCCACCTTATGTATGGGTAAAGATGCACATGAACTCAAAGACAAACGCTATATTGCTGGAATAGCAAATGGTTTGTTTTATGTTTTAGGAGGTGTGTTTGCAGGCAGTATTGTAGCGTTGTTTAGCTTATTGCCCAAAGAGCTGGTTGCTGCACTGGCCGGACTTGCGCTTTTGGGTGCAATAGCAAGCAATATTAAAATTGCCATGCAAGAAGATCAGCAACGAGAT------------------------------CCTGCACTGATTACCTTTTTGGCAACCGTTTCGGGAATGCATTTCTTGGGCTTGAGTTCAGTGTTTTGGGGGATGTGTATTGGCATGCTGGCCTATTTTATT
TRN  10010101100011000
NAM  Q9I374_PSEAE/15-392
ASQ  ADSSPAAVVAG-FVAMLTGYTSSLVLMFQAG---QNAGLSSAQISSWIWALSIGMGLATIGLTLRYRVPIVIAWSTPGAALLISSLPGVPYSEAIGAFIVCALLITLCGVTGSFERLMRQVPSSLASALLAGVLFRIGIEICNAAEQQTLLVLAMFFSYLLCKRFSPRYAVFAALLVGVLLAGILGQLDFSRFRL--ELAVPEWTTPSFSLAATISIGIPLFIVAMASQNMPGIAVLRADGY-QVPASPLISSTGIASILLAPFGSHGINLAAISAAICTGPSAHEDPHKRYTAALWCGFFNCVAGTFGATLAALFAAFPKALVLSIAAIALLGSIMNGLANSMADERQRE----------AALVTFMVTASGFTLLSIGSAFWGLVAGLLTQFV
DSQ  GCCGACTCCTCTCCCGCCGCCGTGGTGGCCGGC---TTCGTCGCCATGCTCACCGGCTACACCAGCTCGCTGGTACTGATGTTCCAGGCCGGG---------CAGAACGCCGGTCTCAGCAGCGCGCAGATTTCCTCGTGGATCTGGGCCCTGTCGATCGGCATGGGCCTGGCGACCATCGGCCTGACCCTGCGCTACCGGGTGCCGATCGTGATCGCCTGGTCCACCCCCGGCGCGGCGCTGCTGATCAGCAGCCTGCCCGGAGTGCCGTACAGCGAGGCGATCGGCGCCTTCATCGTCTGCGCCCTCCTGATCACCCTGTGCGGCGTCACCGGCAGCTTCGAACGCCTGATGCGCCAGGTTCCCTCCTCGCTGGCCTCGGCGCTGCTGGCCGGGGTGCTGTTCCGCATCGGCATCGAGATCTGCAACGCCGCCGAGCAACAGACCCTGCTGGTGCTGGCGATGTTCTTCAGCTATCTGCTGTGCAAACGCTTCTCGCCGCGCTATGCGGTGTTCGCTGCGCTACTGGTGGGGGTGCTGCTGGCCGGGATACTGGGCCAACTGGACTTCAGCAGGTTCCGCCTG------GAACTGGCGGTACCGGAGTGGACCACGCCGAGCTTCTCCCTGGCCGCCACCATCAGCATCGGCATCCCGCTGTTCATCGTCGCCATGGCTTCGCAGAACATGCCCGGCATCGCCGTGCTGCGCGCCGACGGCTAC---CAGGTGCCGGCCTCGCCGCTGATCTCGAGTACCGGCATCGCCTCGATCCTGCTGGCACCGTTCGGCTCCCACGGGATCAACCTGGCGGCGATCAGCGCGGCGATCTGCACCGGTCCCTCGGCCCACGAGGACCCGCACAAGCGCTATACCGCGGCGCTCTGGTGCGGCTTCTTCAACTGCGTCGCAGGAACCTTCGGCGCCACCCTGGCAGCGTTGTTCGCGGCGTTCCCCAAGGCACTGGTACTGTCCATCGCCGCCATCGCCCTGCTCGGCTCGATCATGAACGGCCTGGCCAACTCGATGGCCGACGAGCGCCAGCGCGAG------------------------------GCCGCGCTGGTGACCTTCATGGTAACCGCCTCCGGCTTCACCCTGCTGTCCATCGGCTCGGCGTTCTGGGGCCTGGTGGCCGGCCTGCTGACTCAGTTCGTG
TRN  10010101100011011
NAM  Q9L7Y0_PSEPU/6-383
ASQ  NDSSLSAIVAG-CIATMISYAGPLVIIFHAA---EAAGLSHQQLSSWVWAVSMGSAVLGALLSLRYRVPVVIAWSIPGSALLVTALPQLGLEQAVGAYLVANLLLLLIGISGAFDRIIARLPGSIAAGMQAGILFGFGIEVFRALPVQPLLVLAMFVTYVLMRRVQPRYAVAAVLCVGSLVTLASGAFRSEALVL--ELASPQWITPQFSLPAVFSLALPMVLVALTGQFMPGMAVLRNAGY-ATPASPLISASALAGAVLAPFGCHGLNLAAVTASLCTGHEAHENPRRRYVAAVAGSTLYLLLGIAGATLMSLFAAFPAALIAALAGLALYGAMSEALARSLAEPAERD----------AGLFTFLVTASGVAFLGLSAAFWGLLFGLLAHAL
DSQ  AATGACAGCTCACTGTCCGCCATTGTCGCGGGC---TGCATCGCCACGATGATCTCCTACGCCGGCCCGCTGGTGATCATTTTCCACGCCGCC---------GAAGCGGCCGGGCTTTCTCACCAGCAGTTGTCATCCTGGGTCTGGGCCGTGTCCATGGGCAGTGCCGTGCTTGGTGCGCTGCTCAGTTTGCGCTACCGCGTGCCGGTAGTGATCGCCTGGTCGATCCCAGGCTCCGCGCTGCTGGTCACTGCCTTGCCGCAACTCGGCCTGGAACAGGCCGTAGGTGCCTACCTGGTGGCCAACCTGCTCCTGCTGCTGATCGGCATCAGCGGGGCCTTCGACCGCATCATCGCGCGCTTGCCGGGGTCCATCGCCGCTGGCATGCAGGCTGGCATCCTGTTCGGTTTTGGTATCGAAGTGTTCCGCGCCTTGCCAGTGCAGCCGTTGCTGGTACTGGCGATGTTCGTCACCTACGTGCTGATGCGCCGGGTTCAGCCCCGTTACGCAGTGGCTGCGGTGCTGTGCGTGGGCTCCCTGGTGACCCTGGCCAGCGGTGCGTTCCGTAGCGAGGCGCTGGTGCTG------GAACTGGCTTCGCCGCAGTGGATCACCCCTCAGTTCAGCCTGCCAGCGGTATTCAGCCTGGCGCTGCCGATGGTGCTGGTGGCGCTGACCGGGCAGTTCATGCCGGGCATGGCGGTGCTGCGCAATGCGGGTTAC---GCCACACCGGCCAGCCCGTTGATCAGCGCCAGTGCCCTGGCCGGTGCCGTGCTAGCGCCATTCGGCTGCCACGGGCTGAACCTGGCGGCGGTTACCGCCAGCCTGTGCACGGGCCATGAGGCCCACGAAAACCCACGACGGCGCTATGTGGCGGCAGTGGCTGGCAGCACGCTGTACCTGCTGCTGGGCATTGCCGGTGCCACGCTGATGTCGCTCTTCGCAGCCTTTCCCGCCGCACTGATCGCGGCCCTGGCCGGGCTGGCCCTGTACGGCGCCATGAGCGAGGCGCTGGCCCGCAGCCTGGCGGAACCGGCCGAGCGCGAT------------------------------GCAGGCCTGTTCACCTTCCTGGTCACCGCTTCGGGGGTCGCCTTCCTTGGCCTGTCGGCAGCGTTCTGGGGGCTGCTGTTCGGCCTGCTGGCCCATGCACTG
TRN  11011111101111101
NAM  YDCO_ECOLI/5-381
ASQ  S-IPPPTLLAG-FLAVLIGYASSAAIIWQAA---IVAGATTAQISGWMTALGLAMGVSTLTLTLWYRVPVLTAWSTPGAALLVTGLQGLTLNEAIGVFIVTNALIVLCGITGLFARLMRIIPHSLAAAMLAGILLRFGLQAFASLDGQFTLCGSMLLVWLATKAVAPRYAVIAAMIIGIVIVIAQGDVVTTDVVF--KPVLPTYITPDFSFAHSLSVALPLFLVTMASQNAPGIAAMKAAGY-SAPVSPLIVFTGLLALVFSPFGVYSVGIAAITAAICQSPEAHPDKDQRWLAAAVAGIFYLLAGLFGSAITGMMAALPVSWIQMLAGLALLSTIGGSLYQALHNERERD----------AAVVAFLVTASGLTLVGIGSAFWGLIAGGVCYVV
NAM  Q9RY94_DEIRA/39-426
ASQ  QDTHPSAVLAG-LIAVVIGWAGPNVLIYSVQ---QAGHLSDAAAMSWLWGHAVITGIVGIYLSLRTRMPILSTWSTPGIALLVTALPGMPFAEAVGAFLVSAALVFLLGTFAPLTRAVQAIPTHLAAALNAAILLPFAFKAVQAFGTQPLLVGLMVVTYFLGRQFAPRWAVALVLLVGVAASALLGAWHPAPVPL--APTVPQVVAPAFSVRAMLNLALPLTLLAFTGQFVPGFGVLKANGY-EPAPGPILRACGVASAAAALVGCHNLTLGALLANIVSGPEAHPDAARRYTAAIWAGIFNILFGLFAGTFLHLMGILPAEALAALAGLALLAATGGSLQAAFTPGQSASGRGAAQPGSLAAAVIIAVTLSGVSFFGIGAAFWGILAGLAVHGL
DSQ  CAAGACACCCACCCGAGCGCGGTGCTGGCGGGA---CTGATTGCCGTCGTCATCGGCTGGGCGGGGCCGAACGTGCTGATCTACTCGGTGCAG---------CAGGCCGGGCACCTCAGCGACGCGGCGGCGATGTCGTGGCTGTGGGGCCACGCGGTGATTACGGGCATCGTCGGGATTTACCTCAGCCTGCGGACCCGGATGCCGATTCTTTCCACCTGGTCCACGCCGGGCATCGCGCTGCTCGTCACCGCCCTGCCGGGGATGCCCTTTGCCGAGGCGGTGGGGGCTTTTCTGGTGTCGGCGGCGCTCGTCTTTTTGCTCGGCACCTTCGCGCCGCTCACCCGCGCGGTGCAGGCGATTCCCACCCACCTCGCCGCCGCGCTCAACGCCGCTATTTTGCTGCCCTTCGCGTTCAAGGCGGTGCAGGCGTTCGGCACCCAGCCGCTGCTGGTGGGGCTGATGGTCGTGACCTATTTCCTGGGCCGGCAGTTCGCCCCGCGCTGGGCGGTGGCGCTGGTGCTGCTGGTGGGGGTGGCGGCGAGTGCGCTGCTGGGTGCCTGGCACCCGGCGCCGGTGCCGCTC------GCGCCCACCGTGCCGCAGGTGGTGGCCCCCGCATTCAGCGTGCGCGCCATGCTCAACCTCGCGCTGCCGCTCACGCTGCTCGCCTTTACCGGGCAGTTCGTGCCGGGCTTCGGGGTGCTCAAGGCCAACGGCTAC---GAGCCCGCGCCGGGGCCGATTCTGCGCGCCTGCGGCGTGGCGAGCGCGGCAGCGGCGCTGGTCGGCTGCCACAACCTGACGCTCGGGGCACTCCTCGCCAACATCGTCAGCGGCCCGGAAGCCCACCCCGACGCGGCGCGGCGTTACACGGCGGCCATCTGGGCGGGGATCTTCAACATCCTGTTCGGCCTGTTCGCCGGCACGTTCCTGCACCTGATGGGCATTTTGCCCGCCGAGGCGCTGGCGGCCCTGGCGGGACTGGCACTGCTGGCGGCCACCGGGGGCAGCTTGCAAGCGGCCTTCACACCGGGACAGAGTGCTTCGGGACGGGGCGCGGCGCAGCCTGGCAGCCTCGCCGCCGCCGTCATCATCGCCGTGACGCTCTCGGGCGTGTCCTTTTTCGGCATCGGGGCGGCCTTCTGGGGCATCCTGGCGGGCTTGGCGGTGCATGGGCTG
TRN  11011111101111111
NAM  Q98CP3_RHILO/1-376
ASQ  MTMRLSIPISA-FVAAIVGFGGTLAIVIAAA---HAVGATQIQTASWVTAICLAMAIESLWLSWRTKMPVITAWSTPGLALMAASS-GFSIGEAVAAFIVTAILLIATGLFRPLTQLISRIPPSVASGMLAGIVVTFALNAVKTVPVDPWLILPLIAAFFLIRVFHPALSVLAVLVGGGLAAFLTGRVGGLPTP---ELSTLTLIAPDFTAKAMIGLALPLYLVTMASQNLSGLAVLRAAGY-HPEPGPLIGVTGLFSLLSAPFGGSTTNLAAISAAICTGPDVHPDPAERWKTGPFYALAYVIFAIFGASLVAIFAVLPQSLIVLVAGLALMASLANALAIALKDEGDRM----------AAIVTFVVTASGLTLFGVGAAFWGLIAGLVVLFL
DSQ  GTGACGATGCGCCTTTCCATTCCGATCTCGGCC---TTCGTGGCGGCAATCGTCGGCTTTGGCGGCACGCTGGCCATCGTCATTGCCGCCGCC---------CACGCGGTCGGCGCGACGCAAATTCAGACGGCAAGCTGGGTGACGGCGATTTGCCTGGCCATGGCGATCGAGAGCCTGTGGCTGTCCTGGCGCACCAAAATGCCTGTCATCACCGCGTGGTCGACCCCAGGCCTGGCGCTGATGGCGGCATCGAGC---GGCTTTTCGATCGGCGAAGCCGTGGCCGCCTTCATCGTCACCGCCATCCTGTTGATCGCCACCGGTCTGTTCCGGCCCCTGACGCAATTGATCTCCAGGATACCGCCCTCGGTCGCTTCCGGCATGCTGGCCGGCATTGTCGTTACCTTCGCCCTCAACGCGGTCAAGACCGTTCCCGTCGACCCCTGGCTGATCCTGCCGCTGATCGCGGCCTTCTTCTTGATCCGCGTGTTCCACCCGGCGCTGTCGGTGCTGGCGGTGCTGGTCGGCGGCGGTCTCGCCGCGTTTCTCACCGGCCGTGTCGGCGGCTTGCCGACCCCC---------GAACTGTCGACGCTGACGCTGATCGCGCCTGATTTCACCGCCAAGGCGATGATTGGCCTGGCGCTGCCGCTCTATCTCGTCACCATGGCCTCGCAGAACCTGTCGGGGCTGGCCGTGCTGCGCGCCGCCGGCTAC---CACCCGGAGCCCGGCCCGCTGATCGGCGTCACCGGCCTGTTTTCCCTGCTGTCGGCGCCGTTCGGCGGCTCGACCACCAATCTGGCGGCGATTTCGGCGGCGATCTGCACTGGGCCGGACGTCCATCCCGACCCCGCCGAGCGCTGGAAGACCGGCCCCTTCTATGCGCTCGCCTATGTCATCTTCGCGATTTTCGGCGCGTCGCTGGTGGCGATCTTCGCCGTCCTGCCGCAAAGCCTGATCGTGCTGGTGGCGGGTCTGGCGCTGATGGCCTCGCTGGCCAACGCGCTGGCGATCGCGCTGAAGGATGAGGGCGACCGCATG------------------------------GCCGCCATCGTCACCTTTGTCGTCACCGCTTCGGGATTGACCCTGTTCGGCGTTGGCGCGGCATTCTGGGGGCTGATCGCAGGGCTGGTCGTGCTTTTCCTC
TRN  10010101100011011
NAM  Q9KQM8_VIBCH/4-381
ASQ  GFFNLSHLSAG-FTTVLVGYTSSVVIVIQAA---TASGANPTQIESWLLTLGVVMGLTSILYSWFYKTPIVTAWSTPAAVMLAASAGQYSLPVVIGAFMFSGALFTLTGMLAPLTRALSKIPVPLGTAMLGAILLPFCAKAFTPLTDTPALFALLFTSYLLAKHLVPRYTMLVLLLVSLGSALALGSFQHADLAL--RIATPIWVMPEFDWLAILNLALPLYLITMLSQNLPGIAMLKSYQY-DAPIKPILVGTGLATLMSAPFGGFSVNLAAISAAICMNEDVDQDKAQRYRAVLWAGGFYLLAGIFAALVVNLFLALPKPISAMLAGLALLGTLMMCLQSAFKIDEYRE----------PALLTFVITLSGATLFGMSATLIGLVIGLAYLRL
DSQ  GGATTCTTCAATCTTAGTCACCTCTCTGCGGGA---TTTACCACGGTTTTGGTGGGATACACCAGTTCGGTGGTGATCGTGATCCAAGCCGCC---------ACAGCCTCAGGTGCCAATCCAACTCAAATCGAAAGTTGGTTGCTGACTCTAGGCGTGGTGATGGGGCTAACGTCAATCCTCTACTCTTGGTTTTACAAAACGCCAATTGTCACGGCGTGGTCAACACCTGCGGCAGTCATGCTGGCGGCATCGGCGGGACAATATTCATTACCCGTGGTGATTGGCGCGTTTATGTTCTCTGGCGCACTGTTTACTTTGACGGGCATGCTCGCACCTTTGACACGAGCACTGAGTAAAATCCCAGTTCCTCTAGGTACGGCTATGCTTGGTGCTATTTTGCTGCCCTTTTGTGCCAAAGCCTTCACCCCGCTGACCGATACTCCCGCACTCTTTGCGCTTTTATTTACTAGCTACTTACTGGCTAAGCACCTTGTTCCTCGATACACCATGTTGGTGCTCTTGCTGGTCAGTCTTGGCAGTGCTCTCGCCTTGGGAAGCTTTCAGCATGCGGATCTGGCGCTG------CGGATCGCCACGCCAATCTGGGTAATGCCGGAGTTTGATTGGCTCGCCATACTCAACCTTGCCCTGCCACTCTACCTCATCACCATGCTTTCACAAAATTTACCGGGTATTGCGATGCTCAAAAGCTATCAGTAT---GACGCACCAATCAAACCGATTTTGGTGGGCACGGGATTGGCGACCCTGATGAGCGCGCCTTTTGGCGGCTTTAGCGTCAACTTAGCCGCCATTTCTGCCGCCATCTGTATGAATGAGGATGTCGATCAAGACAAAGCACAACGCTACCGTGCGGTACTTTGGGCTGGAGGATTTTATTTATTGGCAGGGATTTTTGCGGCCCTTGTCGTCAATCTCTTCCTCGCGCTACCCAAACCTATTTCAGCCATGCTCGCTGGTTTAGCGCTGCTCGGTACATTGATGATGTGTTTGCAGAGCGCGTTTAAAATCGATGAGTACCGCGAG------------------------------CCTGCGCTACTCACTTTTGTGATCACGCTTTCTGGTGCCACCTTGTTTGGAATGAGCGCGACGCTGATTGGCCTTGTGATCGGATTGGCGTACTTACGGTTG
TRN  10010101100011000
NAM  Q9RUP7_DEIRA/156-540
ASQ  APAQPCTVGGGRVPAPYFPRAARRGLSDWGAGGFAAAHSSPAQGASALASMYLLLGVMGMTLCWRYRVPVVLGWNTPGLAVLIASAGRFTAAEVVGALLVSGAVLALVGLSRAFDWLARTLPLPLALALLAGVLLPFVLRGLAAIPQAPALTLPTLLAYLLARVFAPRWAVPLALVTGVTVAALTGQLHLSALGHTSLLARPEWITPTFSSQALLTLALPCTILALTSQHLAGMAVLHTHGYRQVPPALLVTVTGAASALAAPLGSVTMNMGAITAAICMGPDVHPDPNRHYVAGLACAGGYLVLGLCAGALLGLAGSFPAPLMQLLAGLALLGSVLSGLQNALSDPRWRE----------GALLAFACTAAGFSFLNIGGALWGLLLGWGSAAL
DSQ  GCGCCGGCCCAGCCCTGCACCGTAGGTGGAGGCCGTGTCCCAGCCCCCTACTTCCCCCGCGCCGCCCGCCGGGGGCTTTCCGACTGGGGCGCTGGTGGCTTCGCGGCGGCGCACTCCTCGCCCGCGCAGGGGGCCAGCGCCCTGGCGAGCATGTACCTGCTCCTGGGCGTGATGGGCATGACCCTGTGCTGGCGCTACCGGGTGCCGGTGGTTCTCGGCTGGAACACGCCGGGGCTGGCGGTTCTGATCGCCTCGGCGGGCCGGTTCACGGCGGCGGAAGTCGTGGGGGCGCTGCTCGTCAGCGGGGCGGTGCTGGCACTGGTGGGCCTGAGCCGGGCCTTCGACTGGCTGGCCCGCACCCTGCCGTTGCCGCTGGCCTTGGCGCTGCTGGCCGGGGTGCTGCTGCCGTTCGTGCTGCGTGGACTGGCGGCCATTCCGCAGGCTCCGGCGCTCACCCTGCCCACCCTGCTCGCCTACCTGCTGGCCCGCGTGTTCGCGCCGCGCTGGGCGGTGCCGCTGGCACTGGTGACCGGGGTAACGGTGGCGGCCCTGACTGGGCAACTGCATTTGAGCGCCCTGGGCCATACGTCGCTGCTGGCACGGCCCGAGTGGATCACTCCCACGTTCAGCTCTCAGGCGCTGCTCACCCTGGCGCTGCCCTGCACTATCCTGGCGCTGACCTCGCAGCATCTGGCGGGTATGGCGGTGTTGCACACCCACGGTTACCGGCAGGTGCCGCCCGCGCTGCTCGTCACGGTCACGGGCGCCGCGTCTGCCCTCGCCGCGCCGCTCGGCAGCGTGACCATGAACATGGGGGCCATCACAGCGGCCATCTGCATGGGCCCGGACGTTCACCCCGACCCGAACCGCCACTACGTCGCGGGGCTGGCCTGCGCGGGCGGTTACCTCGTCCTGGGCCTGTGCGCGGGCGCCCTGCTCGGCCTCGCCGGAAGTTTCCCCGCGCCGCTGATGCAACTGCTGGCAGGACTCGCGCTCCTCGGCTCGGTGCTCAGCGGCCTGCAAAATGCCCTGAGCGACCCGCGCTGGCGCGAG------------------------------GGGGCGCTGCTCGCCTTCGCCTGTACCGCTGCCGGTTTCAGTTTTCTGAATATCGGCGGAGCGCTGTGGGGTCTGCTGCTCGGCTGGGGCAGCGCCGCGCTC
TRN  11011111101111111
//