EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03548 - LolA)
FAM  PF03548
PID  LolA
DES  Outer membrane lipoprotein carrier protein LolA
IPR  IPR004564
ANO  40
ALN  175
AID  0.263285
APH  ((((((Y1483_AQUAE/33-197:1.17717,Y864_RICPR/35-188:0.88000):0.20386,Q6AM51_DESPS/38-207:1.48890):0.13361,(((((LOLA_COXBU/37-201:0.80061,(LOLA_PSEAE/35-198:0.16501,(LOLA_PSESY/34-197:0.04521,LOLA_PSEPK/34-197:0.22505):0.11057):0.42787):0.13521,((((Q6D3U8_ERWCT/32-191:0.07727,((LOLA_ECO57/32-191:0.17916,LOLA_PHOLL/32-191:0.20391):0.04928,LOLA_YERPE/32-191:0.10349):0.05935):0.27188,((LOLA_VIBCH/27-186:0.27854,(LOLA_VIBPA/37-196:0.05722,LOLA_VIBVY/27-186:0.18660):0.14466):0.25493,Q6LT02_PHOPR/29-188:0.21723):0.23762):0.15952,((LOLA_HAEIN/33-192:0.16685,LOLA_PASMU/33-192:0.12112):0.03852,LOLA_HAEDU/36-195:0.37871):0.19894):0.26547,LOLA_SHEON/32-191:0.82197):0.42709):0.09514,((LOLA_NITEU/32-196:0.42577,(LOLA_CHRVO/34-195:0.25874,LOLA_NEIMA/36-197:0.68029):0.10955):0.22594,((LOLA_XYLFA/34-199:0.37949,LOLA_XANCP/32-197:0.10772):0.41337,LOLA_BORPE/38-200:0.77455):0.14185):0.12651):0.24842,Q72BG8_DESVH/37-203:1.48301):0.12326,((Q9ADU7_HELMU/45-186:0.40749,((LOLA_HELPY/33-173:0.51441,LOLA_WOLSU/19-162:0.60003):0.21751,LOLA_HELHP/23-166:0.53660):0.06583):0.20787,LOLA_CAMJE/20-160:0.82808):0.73720):0.20867):0.53918,Q9A261_CAUCR/54-210:0.83164):0.31919,(((Q8FY83_BRUSU/65-219:0.07547,Q6G1V1_BARHE/46-199:0.62653):0.06564,(Q8UBU0_AGRT5/78-233:0.11337,Q92L88_RHIME/54-209:0.16229):0.12663):0.07316,(Q98EH4_RHILO/62-217:0.09458,Q984C3_RHILO/43-198:0.42658):0.09575):0.24206):0.51337,Q89WR1_BRAJA/85-242:0.11791,Q6ND29_RHOPA/147-304:0.15799);
ATP  ((((((Y1483_AQUAE/33-197,Y864_RICPR/35-188),Q6AM51_DESPS/38-207),(((((LOLA_COXBU/37-201,(LOLA_PSEAE/35-198,(LOLA_PSESY/34-197,LOLA_PSEPK/34-197))),((((Q6D3U8_ERWCT/32-191,((LOLA_ECO57/32-191,LOLA_PHOLL/32-191),LOLA_YERPE/32-191)),((LOLA_VIBCH/27-186,(LOLA_VIBPA/37-196,LOLA_VIBVY/27-186)),Q6LT02_PHOPR/29-188)),((LOLA_HAEIN/33-192,LOLA_PASMU/33-192),LOLA_HAEDU/36-195)),LOLA_SHEON/32-191)),((LOLA_NITEU/32-196,(LOLA_CHRVO/34-195,LOLA_NEIMA/36-197)),((LOLA_XYLFA/34-199,LOLA_XANCP/32-197),LOLA_BORPE/38-200))),Q72BG8_DESVH/37-203),((Q9ADU7_HELMU/45-186,((LOLA_HELPY/33-173,LOLA_WOLSU/19-162),LOLA_HELHP/23-166)),LOLA_CAMJE/20-160))),Q9A261_CAUCR/54-210),(((Q8FY83_BRUSU/65-219,Q6G1V1_BARHE/46-199),(Q8UBU0_AGRT5/78-233,Q92L88_RHIME/54-209)),(Q98EH4_RHILO/62-217,Q984C3_RHILO/43-198))),Q89WR1_BRAJA/85-242,Q6ND29_RHOPA/147-304);
ATL  25.2456
DNO  37
DLN  525
DID  0.398485
DPH  ((((Y1483_AQUAE/33-197:0.77631,((LOLA_CAMJE/20-160:0.50767,((LOLA_WOLSU/19-162:0.43993,Q9ADU7_HELMU/45-186:0.34350):0.06609,(LOLA_HELHP/23-166:0.31134,LOLA_HELPY/33-173:0.41449):0.09292):0.06753):0.28515,Y864_RICPR/35-188:0.54327):0.01362):0.24474,((LOLA_SHEON/32-191:0.51830,(((Q6LT02_PHOPR/29-188:0.23297,((LOLA_VIBVY/27-186:0.19060,LOLA_VIBPA/37-196:0.17172):0.07574,LOLA_VIBCH/27-186:0.24126):0.17272):0.11819,((LOLA_PHOLL/32-191:0.19452,LOLA_YERPE/32-191:0.15364):0.07038,Q6D3U8_ERWCT/32-191:0.13913):0.19756):0.12019,((LOLA_PASMU/33-192:0.16440,LOLA_HAEIN/33-192:0.18050):0.04147,LOLA_HAEDU/36-195:0.28146):0.16687):0.21497):0.13044,LOLA_COXBU/37-201:0.67051):0.00307):0.23454,((Q9A261_CAUCR/54-210:0.49585,((((Q984C3_RHILO/43-198:0.35447,Q98EH4_RHILO/62-217:0.09961):0.09086,(Q6G1V1_BARHE/46-199:0.61712,Q8FY83_BRUSU/65-219:0.09061):0.12138):0.02909,(Q92L88_RHIME/54-209:0.16232,Q8UBU0_AGRT5/78-233:0.12383):0.05574):0.19995,(Q6ND29_RHOPA/147-304:0.14830,Q89WR1_BRAJA/85-242:0.08594):0.20332):0.12948):0.32099,(((LOLA_BORPE/38-200:0.45176,LOLA_XANCP/32-197:0.36500):0.09375,((LOLA_NITEU/32-196:0.42155,LOLA_CHRVO/34-195:0.25660):0.07167,LOLA_NEIMA/36-197:0.41421):0.07574):0.12438,(LOLA_PSESY/34-197:0.18052,LOLA_PSEAE/35-198:0.09812):0.23592):0.00000):0.16250):0.11977,Q72BG8_DESVH/37-203:0.63899,Q6AM51_DESPS/38-207:0.84259);
DTP  ((((Y1483_AQUAE/33-197,((LOLA_CAMJE/20-160,((LOLA_WOLSU/19-162,Q9ADU7_HELMU/45-186),(LOLA_HELHP/23-166,LOLA_HELPY/33-173))),Y864_RICPR/35-188)),((LOLA_SHEON/32-191,(((Q6LT02_PHOPR/29-188,((LOLA_VIBVY/27-186,LOLA_VIBPA/37-196),LOLA_VIBCH/27-186)),((LOLA_PHOLL/32-191,LOLA_YERPE/32-191),Q6D3U8_ERWCT/32-191)),((LOLA_PASMU/33-192,LOLA_HAEIN/33-192),LOLA_HAEDU/36-195))),LOLA_COXBU/37-201)),((Q9A261_CAUCR/54-210,((((Q984C3_RHILO/43-198,Q98EH4_RHILO/62-217),(Q6G1V1_BARHE/46-199,Q8FY83_BRUSU/65-219)),(Q92L88_RHIME/54-209,Q8UBU0_AGRT5/78-233)),(Q6ND29_RHOPA/147-304,Q89WR1_BRAJA/85-242))),(((LOLA_BORPE/38-200,LOLA_XANCP/32-197),((LOLA_NITEU/32-196,LOLA_CHRVO/34-195),LOLA_NEIMA/36-197)),(LOLA_PSESY/34-197,LOLA_PSEAE/35-198)))),Q72BG8_DESVH/37-203,Q6AM51_DESPS/38-207);
DTL  16.6736
RID  0.259348
RPH  ((((((Y1483_AQUAE/33-197:1.19277,Y864_RICPR/35-188:0.86740):0.19426,Q6AM51_DESPS/38-207:1.50783):0.14085,(((((LOLA_COXBU/37-201:0.75582,(LOLA_PSEAE/35-198:0.15360,LOLA_PSESY/34-197:0.15400):0.45690):0.12584,(LOLA_NITEU/32-196:0.38682,(LOLA_CHRVO/34-195:0.30330,(LOLA_NEIMA/36-197:0.59793,(LOLA_XANCP/32-197:0.52472,LOLA_BORPE/38-200:0.75625):0.11546):0.16935):0.13043):0.27593):0.09721,(((((LOLA_PHOLL/32-191:0.23086,LOLA_YERPE/32-191:0.09761):0.04701,Q6D3U8_ERWCT/32-191:0.10591):0.24750,((LOLA_VIBCH/27-186:0.27667,(LOLA_VIBPA/37-196:0.05696,LOLA_VIBVY/27-186:0.18711):0.14706):0.25210,Q6LT02_PHOPR/29-188:0.21932):0.24696):0.15959,((LOLA_HAEIN/33-192:0.16306,LOLA_PASMU/33-192:0.12438):0.03935,LOLA_HAEDU/36-195:0.37412):0.19213):0.23716,LOLA_SHEON/32-191:0.85292):0.43332):0.23577,Q72BG8_DESVH/37-203:1.49211):0.14876,((Q9ADU7_HELMU/45-186:0.40462,((LOLA_HELPY/33-173:0.51749,LOLA_WOLSU/19-162:0.59958):0.21563,LOLA_HELHP/23-166:0.54101):0.06645):0.19908,LOLA_CAMJE/20-160:0.83944):0.76882):0.14926):0.52763,Q9A261_CAUCR/54-210:0.83302):0.32151,(((Q8FY83_BRUSU/65-219:0.07426,Q6G1V1_BARHE/46-199:0.62891):0.06713,(Q8UBU0_AGRT5/78-233:0.11332,Q92L88_RHIME/54-209:0.16258):0.12581):0.07123,(Q98EH4_RHILO/62-217:0.09492,Q984C3_RHILO/43-198:0.42708):0.09828):0.23304):0.52245,Q89WR1_BRAJA/85-242:0.12005,Q6ND29_RHOPA/147-304:0.15588);
RTP  ((((((Y1483_AQUAE/33-197,Y864_RICPR/35-188),Q6AM51_DESPS/38-207),(((((LOLA_COXBU/37-201,(LOLA_PSEAE/35-198,LOLA_PSESY/34-197)),(LOLA_NITEU/32-196,(LOLA_CHRVO/34-195,(LOLA_NEIMA/36-197,(LOLA_XANCP/32-197,LOLA_BORPE/38-200))))),(((((LOLA_PHOLL/32-191,LOLA_YERPE/32-191),Q6D3U8_ERWCT/32-191),((LOLA_VIBCH/27-186,(LOLA_VIBPA/37-196,LOLA_VIBVY/27-186)),Q6LT02_PHOPR/29-188)),((LOLA_HAEIN/33-192,LOLA_PASMU/33-192),LOLA_HAEDU/36-195)),LOLA_SHEON/32-191)),Q72BG8_DESVH/37-203),((Q9ADU7_HELMU/45-186,((LOLA_HELPY/33-173,LOLA_WOLSU/19-162),LOLA_HELHP/23-166)),LOLA_CAMJE/20-160))),Q9A261_CAUCR/54-210),(((Q8FY83_BRUSU/65-219,Q6G1V1_BARHE/46-199),(Q8UBU0_AGRT5/78-233,Q92L88_RHIME/54-209)),(Q98EH4_RHILO/62-217,Q984C3_RHILO/43-198))),Q89WR1_BRAJA/85-242,Q6ND29_RHOPA/147-304);
RTL  24.4446
LNK  LOLA_BORPE/38-200:Q7VW06:BX640418
LNK  LOLA_CAMJE/20-160:Q9PNZ0:AL139076
LNK  LOLA_CHRVO/34-195:Q7NXL2:AE016915
LNK  LOLA_COXBU/37-201:P39917:X75627
LNK  LOLA_ECO57/32-191:P61318:
LNK  LOLA_HAEDU/36-195:Q7VLZ6:AE017154
LNK  LOLA_HAEIN/33-192:P45263:U32833
LNK  LOLA_HELHP/23-166:Q7VJC7:AE017145
LNK  LOLA_HELPY/33-173:O25474:AE000590
LNK  LOLA_NEIMA/36-197:P57067:AL162754
LNK  LOLA_NITEU/32-196:Q82VM2:BX321859
LNK  LOLA_PASMU/33-192:P57835:AE006060
LNK  LOLA_PHOLL/32-191:Q7N6E9:BX571864
LNK  LOLA_PSEAE/35-198:Q9I0M4:AE004690
LNK  LOLA_PSEPK/34-197:Q88FS9:
LNK  LOLA_PSESY/34-197:Q9Z3U0:AF095845
LNK  LOLA_SHEON/32-191:Q8EER2:AE015672
LNK  LOLA_VIBCH/27-186:P57069:AE004191
LNK  LOLA_VIBPA/37-196:Q87QP3:AP005076
LNK  LOLA_VIBVY/27-186:Q7MLV4:AP005335
LNK  LOLA_WOLSU/19-162:Q7MRK6:BX571660
LNK  LOLA_XANCP/32-197:Q8P991:AE012302
LNK  LOLA_XYLFA/34-199:Q9PDC7:
LNK  LOLA_YERPE/32-191:Q8ZGC6:AJ414148
LNK  Q6AM51_DESPS/38-207:Q6AM51:CR522870
LNK  Q6D3U8_ERWCT/32-191:Q6D3U8:BX950851
LNK  Q6G1V1_BARHE/46-199:Q6G1V1:BX897699
LNK  Q6LT02_PHOPR/29-188:Q6LT02:CR378666
LNK  Q6ND29_RHOPA/147-304:Q6ND29:BX572593
LNK  Q72BG8_DESVH/37-203:Q72BG8:AE017314
LNK  Q89WR1_BRAJA/85-242:Q89WR1:BA000040
LNK  Q8FY83_BRUSU/65-219:Q8FY83:AE014291
LNK  Q8UBU0_AGRT5/78-233:Q8UBU0:AE009223
LNK  Q92L88_RHIME/54-209:Q92L88:AL591793
LNK  Q984C3_RHILO/43-198:Q984C3:BA000012
LNK  Q98EH4_RHILO/62-217:Q98EH4:BA000012
LNK  Q9A261_CAUCR/54-210:Q9A261:AE006028
LNK  Q9ADU7_HELMU/45-186:Q9ADU7:AF254134
LNK  Y1483_AQUAE/33-197:O67459:AE000742
LNK  Y864_RICPR/35-188:Q9ZCA2:AJ235273
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx..xxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx......xxxxxxxxxxxx......xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q6AM51_DESPS/38-207
ASQ  RQAEAFSTDFIQEKHLAMLNKPVIFRGHLSLIRPDKLRWQFTSPLPSALIFNGEQGMRCDSEGEATpfLLSSdpVMRVVAEQLWNWLG--GDYLKLSKLYRLS---KMEPASLVIHFDKEgAISKILSRVTIRFNEKSLQPEQVKIVERGGDFTRIFFKNPQLNIPLADDLFSRC
DSQ  CGGCAGGCAGAGGCCTTCTCCACGGACTTTATCCAAGAGAAACACCTAGCCATGCTGAACAAGCCGGTGATCTTTCGCGGCCATCTGAGCCTCATTCGCCCGGACAAATTACGTTGGCAGTTCACCTCCCCCCTCCCCTCGGCCCTGATTTTCAACGGTGAACAGGGCATGCGCTGTGACAGCGAAGGTGAAGCCACCccctttCTCCTCTCCTCCgacccaGTGATGCGGGTGGTGGCGGAACAGCTCTGGAACTGGTTGGGC------GGTGATTATCTGAAACTATCCAAGCTCTATAGACTGAGC---------AAGATGGAACCGGCAAGTCTTGTCATCCACTTTGATAAAGAGggaGCGATCTCAAAAATTCTATCCCGGGTAACCATTCGCTTTAACGAGAAGAGCCTACAGCCAGAACAGGTTAAGATCGTTGAAAGAGGAGGTGACTTTACCCGCATTTTCTTCAAAAACCCTCAGCTGAACATTCCGCTGGCAGATGATCTCTTTTCCCGCTGT
TRN  10010101100011000
NAM  Y864_RICPR/35-188
ASQ  RTIKSVAIDFTQEDSYGK-----IVKGKLLIQKPYNFRCNYYPPFPLVIIGTKNFVSMYDYDMEQV..----..SRISPSENIFNFLL--EDNVDFDKDFVFE-SVINKGNIFNITIYHT.---RTEKRSEITFNKNIKQIEKLKIFEDH-NIVTITFDKITKVQKFSDDLFKFK
DSQ  CGCACGATAAAATCTGTTGCGATAGATTTTACTCAAGAAGATTCTTACGGTAAA---------------ATAGTTAAAGGAAAATTGCTAATCCAAAAACCTTATAATTTTAGATGCAATTATTATCCACCTTTCCCTTTAGTTATAATAGGTACTAAAAATTTCGTATCGATGTATGATTATGATATGGAACAAGTA......------------......AGTCGTATTAGTCCTAGTGAAAATATATTTAATTTTTTATTA------GAAGATAATGTGGATTTTGATAAGGATTTTGTTTTTGAA---TCAGTAATTAATAAAGGAAATATTTTTAATATTACTATCTATCATACT...---------AGAACAGAAAAACGTAGCGAAATTACTTTTAATAAAAATATTAAACAAATTGAAAAATTAAAAATATTTGAAGACCAT---AATATAGTAACTATTACTTTTGATAAAATAACTAAAGTACAGAAATTTTCGGATGATTTATTTAAATTTAAA
TRN  10010101110011000
NAM  Y1483_AQUAE/33-197
ASQ  ENTKTIKVSFVQKVKYEWYPKADVSKGIFYASKGGKVRIDYYSPDRVSIFVDRKKVVLVNFEEKVV..YIES..IKRNTSPVIASLFFLSEQPEKVFKP----IGEFKEGDKTVLLLKPL.KKDENVKEVKIYFSKDGE-ILGLKTYDAQGSEISINFIEVVRNYTPTDELFKPS
DSQ  GAAAACACGAAAACGATTAAGGTTTCCTTCGTGCAGAAGGTAAAGTACGAGTGGTATCCGAAAGCGGACGTGAGCAAGGGGATATTTTACGCCTCAAAGGGGGGAAAGGTAAGGATAGATTACTACTCTCCCGACAGAGTTAGTATATTCGTGGACAGGAAAAAAGTTGTACTCGTTAACTTCGAGGAAAAGGTCGTT......TACATAGAGAGT......ATAAAGCGAAACACATCTCCCGTTATAGCGAGTCTTTTCTTCTTATCGGAACAGCCGGAGAAAGTTTTTAAACCC------------ATCGGTGAATTTAAGGAAGGGGATAAAACGGTACTACTCCTAAAGCCCTTA...AAGAAGGACGAGAACGTGAAGGAGGTGAAGATTTATTTCTCAAAAGACGGAGAA---ATTTTAGGACTTAAAACATACGACGCTCAAGGTTCTGAGATTAGTATAAACTTTATAGAAGTTGTTCGCAATTACACGCCTACCGATGAGTTGTTTAAGCCAAGT
TRN  10010101110011000
NAM  Q6G1V1_BARHE/46-199
ASQ  AAIKTMTGDFIQFSPKGK-----MSQGTFYLERPGKIRFIYKK-IPLQIIADGQFIGINNRALNTW..----..NFSKLFQTPMKFLL--DDKINISSGRLLA--FREDPGAVTIVLRDK.--SVGAGQIRMVFDSKTYSLRQWTIVDQQNLETTVQIMNVRTGVRFADGMFTLP
DSQ  GCAGCGATTAAAACAATGACAGGTGATTTTATTCAATTTAGTCCAAAAGGAAAA---------------ATGTCTCAGGGAACATTTTATTTAGAGCGTCCAGGGAAAATTCGTTTTATTTATAAAAAA---ATACCCTTACAGATCATTGCAGATGGTCAATTCATAGGAATTAACAATCGCGCTTTGAATACTTGG......------------......AATTTCTCAAAACTCTTCCAAACACCTATGAAATTTCTGTTG------GACGATAAAATTAATATCTCATCAGGACGTTTATTAGCA------TTTCGTGAAGATCCTGGGGCGGTGACGATTGTTCTGCGGGATAAA...------AGTGTTGGCGCAGGGCAAATACGAATGGTTTTTGATTCTAAAACCTATTCTTTACGGCAATGGACAATTGTTGATCAGCAGAACTTAGAAACCACTGTGCAAATTATGAATGTGCGTACAGGTGTGCGGTTTGCGGATGGGATGTTTACACTTCCC
TRN  10010101100011000
NAM  Q92L88_RHIME/54-209
ASQ  SSVKTMAGEFVQFGPRGE-----QTGGKFYIRRPGRIRFNYEAPSPMRVIADGKSVVIGNMKLKTW..----..DIYPLSKTPLNLLL--SERIDLRSRMVRD--VRVEADLITIVLGDR.-SIFGDSTITMMFDPKSYNLRQWTITDAQKKDTSVMIFNVRTGIALDDKVFRIP
DSQ  TCGTCCGTGAAGACGATGGCCGGCGAATTCGTCCAGTTCGGCCCGCGCGGCGAA---------------CAGACGGGCGGCAAGTTCTATATCCGCCGGCCGGGACGCATCCGCTTCAATTACGAAGCACCCTCGCCGATGCGGGTCATCGCCGACGGCAAGTCCGTCGTCATCGGCAATATGAAGCTCAAGACCTGG......------------......GATATCTATCCGCTCTCGAAGACCCCGCTCAATCTGTTGCTC------AGCGAAAGGATCGACTTGAGAAGCAGGATGGTACGCGAC------GTGAGGGTGGAAGCGGACCTCATCACCATCGTACTCGGCGACCGC...---TCCATCTTCGGAGATTCGACCATCACGATGATGTTCGACCCGAAGAGCTACAATCTGCGGCAGTGGACGATCACCGACGCGCAGAAGAAAGACACGTCGGTGATGATCTTCAACGTCCGGACCGGCATCGCGCTCGACGACAAGGTCTTCCGCATCCCC
TRN  10010101100011011
NAM  Q8UBU0_AGRT5/78-233
ASQ  SSVKTMMGEFVQFGPRGE-----QTGGKFYIERPGKLRFNYEDPSPMRVISDGKNVVIGNMKLKTW..----..DLYPLSKTPLSLLL--SDKIDLGNQKVRD--VKEESDLTTIVLGDK.-SVFGDSTITLMFDPKTFDLRQWTTTDAQNKDTTVMIFNVQTGVNLDERVFNIN
DSQ  TCTTCGGTCAAAACCATGATGGGCGAATTCGTGCAGTTCGGCCCGCGCGGGGAA---------------CAGACCGGCGGCAAGTTCTACATTGAACGGCCCGGCAAGCTTCGCTTCAATTACGAAGACCCCTCGCCCATGCGCGTCATCTCCGATGGCAAGAATGTCGTCATCGGCAACATGAAGCTGAAGACATGG......------------......GATCTCTATCCGCTGTCGAAGACCCCGCTCAGCCTGCTTCTC------TCCGACAAGATCGATCTCGGCAACCAGAAGGTCCGGGAT------GTGAAGGAAGAATCCGACCTGACCACCATTGTCCTCGGCGACAAG...---AGCGTGTTCGGCGATTCGACCATTACCCTGATGTTCGATCCGAAAACTTTCGATCTGAGGCAATGGACGACGACCGACGCCCAGAACAAGGACACGACAGTCATGATCTTCAACGTCCAGACGGGCGTGAACCTCGATGAACGTGTCTTCAACATCAAT
TRN  10010101100011011
NAM  Q8FY83_BRUSU/65-219
ASQ  SSARTMTGEFVQFGPRGE-----QTGGTFYIERPGKIRFNYNN-SPIRVISDGDSVVINNRKLDTW..----..DLYPLSKTPLKLLL--ADRIDLGGGRLQS--VKQEPDMTTLVLGDK.-SVFGDSKITMMFDPKSYDLKQWTITDAQKLDTTVMIFNVRTGVRFTNDMFKID
DSQ  TCATCGGCGCGTACGATGACGGGCGAATTCGTGCAGTTCGGCCCCAGGGGTGAG---------------CAGACTGGTGGCACGTTCTATATCGAGCGTCCGGGCAAGATCCGCTTCAATTACAACAAT---TCTCCGATCCGCGTGATTTCAGACGGAGATTCGGTTGTCATCAACAATCGCAAGCTCGACACATGG......------------......GATCTCTATCCGCTTTCAAAAACGCCGCTGAAACTGCTTCTG------GCCGACAGGATCGATCTTGGTGGCGGTCGCCTTCAGAGC------GTGAAGCAGGAACCGGACATGACCACGCTGGTTCTGGGCGACAAG...---TCGGTATTCGGTGATTCCAAGATCACCATGATGTTCGATCCCAAGTCTTATGATCTGAAGCAATGGACGATCACCGACGCGCAGAAACTCGATACGACCGTGATGATCTTCAACGTACGCACCGGCGTGCGCTTTACCAACGATATGTTCAAGATCGAT
TRN  10010101100011001
NAM  Q98EH4_RHILO/62-217
ASQ  SSVKSMSGEFVQFGPKGE-----QTGGKFFLERPGKIRFNYDGASNFKVISDGKSVVILNKKMNTS..----..DLYPLSKTPLKLLL--DDRIDLSGDRVKS--VKEEDDLTTIQLSDK.-AVFGNARITMMFDPKTYDLRQWTITDAQGKDTTVMIFNTKEGVSFAPDTFAID
DSQ  TCCTCGGTCAAATCGATGAGCGGCGAATTCGTGCAGTTCGGCCCTAAGGGCGAG---------------CAGACCGGTGGCAAATTCTTCCTCGAGCGGCCGGGCAAGATCCGCTTCAACTATGACGGGGCGTCGAATTTCAAGGTGATCTCCGACGGCAAGTCGGTGGTCATCCTCAACAAGAAAATGAACACGTCG......------------......GACCTTTATCCGTTGTCGAAGACGCCGCTGAAGCTGCTGCTC------GATGACCGGATCGACCTCTCCGGCGACCGCGTCAAAAGC------GTCAAGGAAGAAGACGACCTCACCACCATCCAGCTTTCCGACAAG...---GCGGTGTTCGGCAACGCGCGCATCACCATGATGTTCGATCCGAAAACCTATGATCTGCGCCAGTGGACGATCACCGACGCGCAGGGCAAGGACACGACGGTGATGATCTTCAACACCAAGGAAGGCGTCAGCTTCGCGCCCGACACCTTTGCCATCGAC
TRN  11011101101011011
NAM  Q984C3_RHILO/43-198
ASQ  SSVKSMSGNFVQSDPRGE-----KTSGRFFLQRPGKIRFNYTGQSGISLIADGQSVVIYNKKLKTS..----..RLYALSKTPLKLLL--DDKVEFSGNRLKG--IKDDGAQVTIKLADK.-SAFGNSNITMVFDRKSLDLRRWSITDERGQSTTVTLSNVREGVRAPPGTFMID
DSQ  TCATCCGTAAAGTCCATGTCCGGGAACTTCGTCCAGTCTGACCCAAGAGGAGAA---------------AAGACCAGCGGTAGATTTTTTCTCCAACGCCCGGGAAAAATTCGGTTCAATTATACGGGCCAATCAGGGATCAGCTTAATCGCAGATGGACAATCCGTCGTAATCTATAACAAAAAGCTGAAGACATCG......------------......CGCCTCTATGCTCTTTCGAAGACGCCGCTCAAGCTTCTACTG------GACGACAAGGTCGAATTCTCTGGCAATCGCCTCAAAGGC------ATCAAAGACGATGGCGCCCAGGTTACCATCAAGCTGGCCGACAAG...---TCGGCCTTCGGAAACTCGAACATCACTATGGTCTTCGATAGGAAATCACTCGATCTGCGCAGATGGAGCATCACTGACGAAAGAGGACAGAGTACGACAGTCACTCTCTCGAATGTGAGGGAAGGCGTTCGTGCCCCTCCAGGCACCTTCATGATCGAC
TRN  10010101100011000
NAM  Q6ND29_RHOPA/147-304
ASQ  SSLQTLVGQFVQVGPDGS-----KLTGDFYIMKPGRVRFEYDDPSPISMIADGQSVVVRDRKLATQ..----..DVYPLSQTPLRYLL--SDRLDLLRDTNVV-SITSDDLYSNIIIEEK.NAVIGTSRLLLMFGTKDGQLKQWTVTDPQGYDTTVAVYNLDTTRRPDPSMFKID
DSQ  TCGTCGCTGCAGACTCTCGTCGGCCAGTTCGTCCAGGTCGGGCCGGACGGCAGC---------------AAGCTGACCGGCGATTTCTACATCATGAAACCCGGCCGGGTGCGGTTCGAGTATGACGACCCGAGCCCGATCTCGATGATCGCCGACGGCCAGTCGGTGGTGGTGCGTGATCGCAAGCTGGCGACCCAG......------------......GACGTCTATCCGCTGTCGCAGACGCCGCTGCGCTATCTGCTC------AGCGACCGGCTCGATCTACTCCGCGACACCAACGTCGTC---AGCATCACCTCCGACGATCTGTATTCGAACATCATCATCGAAGAGAAG...AACGCCGTCATCGGCACCAGCCGCTTGCTGCTGATGTTCGGCACCAAGGACGGCCAGCTCAAGCAATGGACCGTCACCGATCCGCAGGGCTACGACACCACCGTCGCGGTGTACAATCTCGACACTACCAGGCGCCCTGATCCGTCGATGTTCAAGATCGAC
TRN  10010101100011011
NAM  Q89WR1_BRAJA/85-242
ASQ  SSLSTLVGNFVQVGPDGS-----KTQGDFYIQKPGKVRFEYDAPSPIDIVADGSSLVVRDRKLATQ..----..DVYPLSQTPLRFLL--SDRIDLMKDTNVV-NVSADDVFVSVTIEEK.QALVGTSRLLLMFGAKDGQLKQWTVTDPQGYDTTIAVYNLDATKKLDPGMFKID
DSQ  TCCTCGCTGTCGACGCTGGTCGGTAATTTCGTCCAGGTCGGCCCCGACGGCAGC---------------AAGACGCAGGGCGATTTCTACATCCAGAAGCCGGGCAAGGTGCGCTTCGAATATGACGCGCCGAGCCCGATCGACATCGTCGCCGACGGATCGTCGCTGGTGGTGCGCGATCGCAAGCTCGCGACCCAG......------------......GACGTCTATCCGCTGTCGCAGACGCCGCTGCGCTTCCTGCTG------TCCGATCGCATCGACCTGATGAAGGACACCAACGTCGTC---AACGTCTCGGCCGACGACGTCTTCGTCAGCGTCACCATCGAGGAGAAG...CAGGCGCTGGTCGGCACCAGCCGCCTCCTGCTGATGTTCGGCGCCAAGGACGGCCAGCTGAAGCAGTGGACCGTCACCGACCCGCAGGGCTACGACACCACGATCGCGGTCTACAATCTCGACGCAACCAAGAAGCTCGATCCCGGCATGTTCAAGATCGAC
TRN  11011111101111111
NAM  Q9A261_CAUCR/54-210
ASQ  QGLSSAKGRFVQTDQRGT-----QTQGTFYLQRPGKARFAYDPPAGLLVVSNGNNVNIFDSRLKTY..----..ESYPLSKTPLNLLL--AREVRLDRGVVIT-DVRPLADGFTIVAQDA.-KRQALGRISIDFSNGLVGLMGWTVTDIKGGQIRVRLSDFAETADLDPKLFVLT
DSQ  CAGGGGCTGTCCTCGGCCAAGGGTCGCTTTGTGCAGACCGATCAGCGCGGAACC---------------CAGACCCAAGGGACCTTCTATCTGCAGCGCCCCGGCAAGGCGCGGTTCGCCTATGATCCGCCGGCGGGCCTGCTGGTCGTCAGCAACGGCAATAACGTCAACATCTTCGACAGCCGCCTGAAGACCTAT......------------......GAGAGCTATCCGCTCAGCAAGACGCCGCTGAACCTGCTGCTG------GCGCGCGAGGTTCGCCTGGATCGCGGCGTGGTCATCACC---GATGTCCGGCCGCTGGCCGACGGCTTCACGATCGTGGCGCAAGACGCC...---AAGCGCCAGGCGCTGGGCCGCATCTCGATAGACTTCTCGAACGGCCTCGTCGGCCTGATGGGCTGGACGGTCACCGACATCAAGGGCGGCCAGATCCGCGTGCGCCTCAGCGACTTCGCCGAGACGGCGGATCTCGACCCCAAGTTGTTTGTCCTGACC
TRN  10010111100111011
NAM  LOLA_CAMJE/20-160
ASQ  LNFNTFSSNFTQIVKSKNSTL--SYSGHFILSKD-QAYWSYDTPSKKEIYINKNQVTIVEHDLEQV..----..IFSHLDNIPNLNEIFKKASLIDKDKLVAK-----------------.---YDNINYTIKLNQEQ--IQSISYKDEFENDVIINLNNQIKNPKINSDVFKAK
DSQ  CTTAATTTTAATACCTTTTCAAGCAATTTTACCCAAATAGTGAAATCCAAAAACTCTACACTT------TCTTATTCTGGGCATTTTATACTGAGTAAAGAT---CAAGCATATTGGAGTTATGATACTCCTAGTAAAAAAGAGATTTATATCAACAAAAATCAAGTAACCATAGTAGAGCACGATCTAGAACAAGTC......------------......ATTTTCTCTCATCTTGATAACATTCCAAATCTTAATGAAATTTTCAAAAAAGCAAGTCTTATAGACAAAGATAAACTTGTAGCAAAA---------------------------------------------------...---------TATGATAATATAAATTATACAATTAAACTCAATCAAGAGCAA------ATTCAAAGCATATCCTATAAAGATGAATTTGAAAATGATGTTATAATCAATCTAAACAATCAAATTAAAAATCCAAAAATTAATTCCGATGTTTTTAAGGCAAAA
TRN  10010101100011001
NAM  LOLA_WOLSU/19-162
ASQ  ESIGSFRSEFVQTIRSEDGKII-EYRGRVYAKSPYYGLWKYEKPMEKEIYIVDKQVVIYEPALEQA..----..TVSSLQNSIDFMALLRQSKRNSEGIYEAT-----------------.---VFEQKYQILADEKGE-PQKVFFIDKLHNEVQIIFKNAEINPVLEKEMFLFM
DSQ  GAGTCGATCGGCTCGTTTAGATCGGAATTTGTCCAAACCATCCGTTCTGAAGATGGAAAGATTATC---GAATATCGAGGTCGTGTCTATGCCAAATCCCCTTACTATGGGCTTTGGAAGTATGAAAAGCCAATGGAAAAAGAGATATACATCGTGGATAAACAGGTGGTGATCTATGAGCCTGCGTTAGAGCAGGCG......------------......ACCGTCTCCTCTCTTCAAAACTCCATCGATTTTATGGCGCTCCTTAGACAATCCAAGCGCAACAGTGAGGGAATCTATGAGGCGACC---------------------------------------------------...---------GTGTTTGAACAAAAGTACCAGATTTTAGCCGATGAGAAGGGAGAG---CCCCAAAAAGTCTTCTTTATAGACAAGCTTCACAATGAAGTGCAGATCATCTTTAAAAATGCCGAAATCAATCCCGTGCTCGAAAAGGAGATGTTCCTCTTTATG
TRN  10010101110011010
NAM  LOLA_HELHP/23-166
ASQ  ENLQSIEADFEQIAVNEDGVPT-RYEGHIIGKMPSKVKWDYKAPLQKEIYMNKNEVIMYEPRLEQV..----..SHSRLKDKADFLSILKSAKKHNDGTYHTK-----------------.---VDGIEYVLFIDKAQK-PERIEFVDSMGVKTTLKLKNVKLNGAISDKKFVFV
DSQ  GAGAATTTACAGAGCATAGAAGCGGATTTTGAACAGATTGCTGTGAACGAAGATGGTGTGCCTACT---CGTTATGAGGGACATATCATAGGAAAAATGCCAAGTAAGGTTAAATGGGATTATAAAGCGCCTTTGCAAAAAGAAATTTATATGAATAAAAATGAAGTTATTATGTATGAGCCGCGTTTAGAGCAAGTA......------------......AGCCATTCACGTTTAAAGGATAAAGCAGATTTTCTCTCTATCCTTAAATCCGCTAAAAAGCATAATGATGGCACATATCATACGAAA---------------------------------------------------...---------GTTGATGGTATAGAATATGTGCTTTTTATAGATAAAGCACAAAAG---CCAGAACGCATTGAATTTGTAGATTCTATGGGCGTAAAAACAACGCTCAAACTAAAAAATGTCAAGCTCAATGGGGCTATCAGCGATAAAAAATTTGTTTTTGTG
TRN  10010101110011000
NAM  Q9ADU7_HELMU/45-186
ASQ  NGLISIEADFVQITHQGSQKL--IYTGKLYAKNPSLAKWIYETPLKKTIYLNKKEAIIYEPMLEQA..----..TFTHLTKQVDFFAILHKATLGQDGKYHAK-----------------.---VGDAQYVLSFAKNL--PHKITFIDELQNKIEIILKNLKVNPTLSDGIFVFT
DSQ  AATGGGCTTATTAGCATAGAAGCGGATTTCGTGCAGATCACTCACCAAGGGAGCCAAAAGCTC------ATCTACACAGGCAAGCTCTATGCCAAAAATCCCAGTCTGGCCAAATGGATCTATGAAACCCCACTGAAAAAAACCATCTATCTCAACAAAAAAGAGGCCATTATCTATGAGCCTATGCTTGAGCAAGCC......------------......ACTTTCACACATCTCACAAAGCAGGTGGATTTTTTTGCGATCCTGCACAAAGCCACTCTGGGGCAAGATGGCAAATACCACGCGAAG---------------------------------------------------...---------GTGGGGGATGCGCAGTATGTGCTCTCCTTTGCCAAAAATCTG------CCGCATAAAATTACCTTTATTGATGAGTTGCAAAACAAAATCGAGATTATTTTGAAAAATCTCAAGGTCAATCCCACTTTGAGTGATGGGATTTTTGTTTTTACC
TRN  10010101100011011
NAM  LOLA_HELPY/33-173
ASQ  QHLQSFSAHFKQVLKNEKPL---VYYGVLKAKAPNWALWVYEKPLKKEIYMNDKEVVIYEPNLFQA..----..TITPLKDKTDFFTILKRLKKQDDGSFKTT-----------------.---INKTTYRLVFKDGK--PFSLEFKDGMNNLVTITFSQAEINPTIANEIFVFK
DSQ  CAGCATTTGCAAAGTTTTAGCGCGCATTTCAAGCAGGTTTTAAAAAATGAAAAACCTTTA---------GTTTATTACGGGGTTTTAAAGGCTAAAGCCCCTAATTGGGCTTTATGGGTTTATGAAAAGCCTTTAAAAAAAGAAATTTACATGAACGATAAAGAAGTGGTAATTTATGAGCCTAATTTGTTTCAAGCG......------------......ACCATCACGCCCTTAAAAGACAAGACGGATTTTTTCACCATTCTCAAGCGTTTAAAAAAGCAAGATGACGGATCTTTTAAAACGACT---------------------------------------------------...---------ATCAACAAAACCACTTATCGTTTGGTTTTTAAAGACGGCAAG------CCTTTTTCATTGGAATTTAAAGATGGAATGAACAATCTTGTAACGATCACTTTTTCTCAAGCAGAAATCAACCCCACCATTGCTAATGAAATCTTTGTTTTTAAG
TRN  11011101111011000
NAM  Q72BG8_DESVH/37-203
ASQ  DTVTTLKAAFTQKLLHRESGSTETRNGTLLFRKPLLVRWETGGKNPEVLVISSQDIWNFLPDEELA..YRYP..LDLVQDSKSIIKVI--TGQAKLDQDFNVV-EEGQEEGLTRLHLYPK.EPVQQLTEAILWVDPQEHLIRRVRVYDFYGNENEIDFTSLEANATVADKAFTFT
DSQ  GATACGGTGACCACCCTCAAGGCGGCATTCACCCAGAAACTGCTGCATCGTGAGAGCGGTTCGACCGAGACGCGCAACGGCACCCTGCTTTTCCGCAAGCCCCTTCTCGTACGATGGGAGACCGGTGGAAAGAATCCGGAGGTGCTGGTCATCTCATCGCAGGACATCTGGAACTTCCTGCCCGATGAGGAACTCGCC......TACCGTTACCCG......CTAGACCTCGTGCAGGACTCGAAGTCCATCATCAAGGTCATC------ACGGGACAGGCGAAGCTCGATCAGGACTTCAATGTCGTC---GAAGAAGGACAAGAGGAAGGGCTCACCCGGCTGCACCTCTACCCGAAG...GAGCCTGTGCAGCAGTTGACTGAAGCCATCCTGTGGGTCGACCCGCAGGAGCACCTCATCCGCCGCGTTCGCGTCTACGACTTCTACGGGAACGAGAACGAGATAGACTTCACGAGCCTTGAAGCCAACGCGACCGTGGCGGACAAGGCATTCACCTTCACG
TRN  10010101100011001
NAM  LOLA_SHEON/32-191
ASQ  TGTESLKADFKQTVTDVNKKVIQSGAGVFALAHPNQFYWHLTAPDESKIVADGKDLWIYNPFAEEV..VIMD..FTQAITASPIALLV--HRDDATWSQYAVT------KKQDCYEIKPK.ATDAGISAVNVCFNKGT--LNKFNVLDDKGNLSQFDLSNQHSISTGDKALFKFV
DSQ  ACGGGTACAGAATCTCTCAAGGCGGATTTTAAGCAAACCGTTACCGATGTGAATAAAAAGGTCATTCAAAGCGGTGCGGGCGTATTTGCACTGGCTCACCCTAATCAGTTTTATTGGCATTTAACCGCGCCAGATGAGTCAAAAATTGTCGCCGACGGTAAAGATTTATGGATCTACAACCCCTTTGCCGAAGAAGTG......GTGATCATGGAT......TTTACCCAGGCCATTACTGCATCGCCCATCGCCTTATTAGTT------CACCGTGATGATGCTACTTGGTCACAGTACGCGGTGACG------------------AAAAAACAAGATTGTTATGAGATCAAACCTAAG...GCGACTGACGCCGGTATTTCTGCGGTCAATGTATGTTTTAACAAAGGCACG------CTGAATAAATTTAATGTGCTTGACGATAAAGGAAATCTTAGCCAGTTTGACTTAAGCAACCAACACAGCATTAGCACTGGGGATAAAGCGCTCTTCAAATTTGTG
TRN  11011101101011000
NAM  Q6LT02_PHOPR/29-188
ASQ  SLVNAFSANFDQKVVSPEGDVLVEGKGDVTIKRPNLFRWNTVTPDENLLVSDGKTLWYYSPFIEQV..TAMW..LKDATEQTPFVLLT--RNSASDWDNYNVA------QTSDTFTLTPK.DTTSTMGKFVVTVAKTGE-VRNFSVVEQDGQRSNFKFRQFS-KQVPKANIFTFT
DSQ  AGTTTGGTGAATGCATTCAGTGCTAATTTTGACCAGAAAGTTGTTAGCCCTGAAGGTGATGTTCTGGTAGAAGGAAAAGGGGATGTAACAATTAAACGTCCTAATTTATTTCGCTGGAACACAGTCACACCTGATGAAAATTTACTGGTTTCTGATGGTAAAACGTTGTGGTACTACAGCCCATTTATCGAACAAGTC......ACCGCAATGTGG......TTGAAAGATGCCACGGAGCAAACACCATTTGTACTGCTAACG------CGTAATAGCGCGAGTGATTGGGATAATTATAACGTGGCT------------------CAAACGTCAGACACCTTCACGCTAACGCCGAAA...GATACAACTTCAACGATGGGTAAGTTTGTTGTTACCGTTGCAAAAACGGGTGAA---GTGCGTAATTTTTCTGTCGTAGAGCAAGATGGTCAGCGCAGCAATTTCAAATTCCGTCAGTTCAGC---AAGCAAGTGCCAAAAGCGAATATATTTACTTTTACG
TRN  10010101100011000
NAM  LOLA_VIBVY/27-186
ASQ  GMNDGFSANFNQTVTSPEGEVVMEGEGSVDIARPSLFRWSTSLPDENLLVSDGKTLWYYSPFIEQV..SIYW..QEQAVQQTPFVLLT--RNQSSDWENYQIT------QDGNVFTLVPK.AADSTQGQFQIDIDAKGI-VHGFNVIEQDGQKGIFKFTDMK-LGKPAAARFTFN
DSQ  GGCATGAATGATGGCTTTAGCGCAAACTTCAACCAAACGGTGACAAGCCCAGAGGGTGAAGTCGTGATGGAAGGGGAAGGCAGCGTTGATATTGCCAGACCAAGCCTGTTTCGCTGGAGTACCTCTTTACCGGATGAAAACCTGTTGGTTTCGGATGGAAAAACCTTATGGTATTACAGCCCATTTATTGAACAGGTA......AGCATTTACTGG......CAAGAACAAGCTGTACAACAAACACCGTTTGTTTTACTCACT------CGTAATCAGTCCAGTGATTGGGAAAACTATCAAATCACA------------------CAAGATGGTAATGTGTTCACTCTCGTGCCGAAA...GCGGCAGACTCTACCCAGGGGCAGTTCCAAATTGATATTGATGCAAAAGGGATT---GTGCATGGTTTTAATGTCATTGAACAAGATGGGCAAAAAGGCATCTTCAAGTTTACGGATATGAAG---CTAGGAAAGCCTGCAGCTGCCCGCTTCACCTTTAAC
TRN  10010101100011010
NAM  LOLA_VIBPA/37-196
ASQ  AMNEGFSADFSQQVISPEGETVMEGEGTVEIARPSLFRWSTTFPDENLLVSDGKTLWYYSPFIEQV..SIYW..QEQATEQTPFVLLT--RNRASDWDNYKIS------QKGNEFTLIPT.AVDSTQGQFQINIDAKGV-VKGFNVIEQDGQKGLFTFSNVK-LGKPKADRFTFT
DSQ  GCGATGAATGAAGGCTTCAGTGCCGATTTCTCTCAGCAAGTGATCAGCCCAGAAGGGGAAACGGTCATGGAAGGGGAAGGCACGGTTGAAATCGCTCGTCCAAGCCTTTTCCGTTGGAGCACGACATTCCCAGATGAGAACTTGTTGGTTTCAGACGGTAAAACTTTGTGGTACTACAGCCCGTTTATTGAGCAAGTC......AGCATTTACTGG......CAAGAGCAAGCGACCGAGCAAACACCATTTGTACTCTTAACT------CGCAACAGAGCAAGTGATTGGGATAATTATAAGATCTCC------------------CAGAAAGGGAATGAATTTACGCTTATCCCAACC...GCAGTAGACTCTACTCAAGGTCAGTTCCAGATCAATATTGACGCGAAAGGCGTA---GTGAAAGGCTTTAACGTCATCGAGCAAGATGGTCAGAAAGGGCTCTTTACATTCAGTAATGTTAAG---CTTGGCAAACCAAAAGCAGACAGATTTACGTTCACA
TRN  10010101110011000
NAM  LOLA_VIBCH/27-186
ASQ  AMSEGFSATFNQQVLSPEGKVILTGNGKVDIARPSLFRWETETPDENLLVSDGTTLWHFDPFVEQV..TLYR..AEEALEQTPFVLLT--RNKASDWDAYHVE------EKGDVFTLTPT.ALDSNQGRFQITISEKGV-VQGFKVIEQDGQQSEFTFSKVK-QQKPNASVFNYK
DSQ  GCCATGAGTGAAGGCTTCAGCGCGACCTTTAATCAGCAAGTATTAAGCCCAGAGGGCAAAGTGATCCTGACCGGAAATGGCAAGGTGGATATTGCTCGTCCGAGCCTATTTCGTTGGGAAACCGAAACGCCAGATGAAAACTTACTGGTCTCTGACGGTACAACCTTATGGCATTTCGACCCTTTCGTGGAGCAGGTC......ACCTTGTACCGC......GCCGAAGAAGCTTTAGAGCAGACGCCTTTTGTGCTGCTGACT------CGTAATAAAGCCAGCGATTGGGATGCCTATCATGTGGAA------------------GAAAAGGGTGATGTATTTACTCTGACGCCTACT...GCGCTGGATTCAAACCAAGGCCGTTTCCAAATCACCATCAGTGAGAAAGGGGTG---GTACAAGGTTTTAAAGTGATTGAGCAAGATGGTCAGCAGAGCGAATTTACCTTTAGTAAGGTGAAA---CAGCAGAAACCAAACGCTAGCGTATTTAACTACAAA
TRN  11011101101011000
NAM  LOLA_HAEDU/36-195
ASQ  EHVAQYSADFEQTVRSSKGQQIQSGRGKFQVKRPNLFRMDINAPQENVIVSDGENLWFYDPFVAQV..TVNS..VQNAVNGTPFVLLT--SSDKQHWTQYEVT------QNADTFVLKPK.SAKNNLRQFDVQIDQNGL-LKGFSTIERDGQTNLYRLRNIT-TADLSADLFKFS
DSQ  GAGCACGTTGCTCAATATAGTGCGGATTTTGAACAAACTGTGCGTTCAAGCAAAGGCCAACAAATTCAATCAGGTCGCGGTAAATTTCAGGTTAAACGTCCAAACTTGTTTAGAATGGATATTAACGCACCGCAAGAAAACGTAATTGTATCGGATGGCGAAAACTTATGGTTTTATGATCCTTTTGTGGCACAAGTT......ACCGTTAATAGT......GTGCAAAATGCAGTAAATGGTACGCCTTTTGTGTTGTTAACC------AGTAGCGATAAACAACATTGGACACAATATGAAGTAACA------------------CAAAATGCAGATACATTTGTACTAAAACCAAAG...TCAGCCAAAAATAACTTAAGGCAATTTGATGTACAGATCGATCAAAATGGCTTG---TTAAAAGGGTTTAGTACTATTGAGCGTGATGGTCAAACTAACTTATATAGACTACGTAATATCACA---ACGGCAGATTTATCTGCGGATCTGTTTAAGTTTAGC
TRN  10010101100011000
NAM  LOLA_PASMU/33-192
ASQ  SKVNVLSADYAQTVSSSDGKNVQQGSGTLKIKRPNLFRMDNKTPQENQIISDGKTLWFYDPFVEQV..TANW..VKDAVNNTPFVLLT--SDDSSHWAQYNVE------QKADTFTLKPK.AKQSNIKQFDIRIDSEGV-LRNFSTIEKDGQTNLYILRNIT-NQPLADGIFKFS
DSQ  AGCAAGGTGAATGTGTTGAGTGCTGATTATGCTCAAACAGTCAGTTCGTCAGACGGAAAAAATGTTCAACAAGGCAGTGGGACATTAAAAATCAAGCGTCCAAATTTATTCCGAATGGATAATAAAACACCGCAAGAAAACCAGATTATTTCAGATGGGAAAACCTTGTGGTTTTATGATCCCTTTGTTGAGCAAGTG......ACAGCAAATTGG......GTCAAAGATGCCGTGAATAACACACCTTTTGTTTTGTTGACG------AGTGACGATAGCAGCCACTGGGCACAATACAATGTGGAA------------------CAAAAGGCAGATACATTTACCCTCAAGCCAAAA...GCAAAGCAGAGTAATATTAAGCAGTTTGATATTCGTATTGATAGTGAAGGGGTA---TTGCGTAACTTCAGTACTATTGAAAAAGATGGTCAAACGAATTTGTATATTTTACGTAATATTACC---AACCAACCTTTAGCCGATGGTATATTCAAGTTTAGT
TRN  10010101110011000
NAM  LOLA_HAEIN/33-192
ASQ  AKVDVLSAEFVQTVTSGSGKNVQQGSGKLQIKRPNLFRMETKTPQETQIISDGKTLWFYDPFVQQV..TAQW..VKNAVNNTPFVLLT--SNDKSHWHQYTVT------QQSDTFVLKPT.LSTSNIKQFDIRVDANGI-LRNFSTTEKDGQTNLYVLRNIT-NQTLSDSLFQFK
DSQ  GCTAAAGTCGATGTATTAAGTGCAGAATTTGTGCAAACAGTGACTTCTGGAAGTGGAAAAAATGTTCAACAAGGAAGTGGCAAACTTCAAATTAAACGCCCAAATTTATTCCGTATGGAGACTAAAACCCCTCAAGAAACCCAGATTATTTCTGATGGTAAAACCTTATGGTTCTACGATCCATTTGTGCAACAAGTG......ACCGCACAATGG......GTAAAAAATGCGGTAAATAATACTCCTTTTGTTTTGCTTACC------AGCAATGATAAGAGCCATTGGCATCAATATACGGTAACA------------------CAACAATCGGATACCTTTGTGTTAAAACCAACC...TTATCCACAAGCAACATTAAGCAATTTGATATTCGTGTTGATGCTAATGGAATA---TTGCGAAATTTCAGTACGACAGAGAAAGATGGGCAAACCAATCTTTATGTTTTACGTAATATTACG---AATCAAACCTTGTCTGATAGCTTGTTCCAATTCAAG
TRN  10010101110011010
NAM  LOLA_PHOLL/32-191
ASQ  GKVNSFHASFTQTVTSDDGATIQEGEGQLWVKRPNLFNWHMTSPDESVLVSDGKTLWFYNPFVEQV..TANW..LKDATGNTPFMLIT--RNDAKEWSQYKIS------QQGNDFELTPN.NVTGNLKRFSITVTTDGT-IQKFSAIEQDGQKSAYQLKGQQ-NTHVDAAKFSFT
DSQ  GGTAAAGTAAATAGTTTTCATGCTAGCTTTACTCAAACCGTCACCAGTGATGATGGGGCAACAATTCAGGAAGGTGAGGGGCAATTATGGGTTAAACGTCCAAACCTATTTAATTGGCATATGACATCACCTGATGAAAGTGTTTTGGTATCGGATGGTAAAACATTGTGGTTCTATAATCCGTTTGTTGAGCAGGTA......ACGGCTAATTGG......TTGAAAGATGCCACAGGTAATACGCCATTTATGCTAATTACT------CGTAACGATGCTAAAGAATGGTCTCAATATAAAATTAGC------------------CAGCAAGGGAATGATTTTGAACTGACGCCGAAT...AATGTCACTGGTAATCTGAAACGTTTCTCGATTACCGTTACGACGGATGGCACT---ATCCAAAAATTTTCTGCTATTGAGCAGGATGGACAAAAGAGTGCTTATCAACTAAAAGGGCAGCAA---AATACCCACGTAGATGCGGCAAAGTTCAGTTTTACG
TRN  11011101101011000
NAM  LOLA_YERPE/32-191
ASQ  SKVNSFHASFSQAVTSSDGAVVQEGEGELWVKRPNLFNWHMTSPDESVLISDGETLWFYNPFVEQA..TATW..LKNATGNTPFMLIT--RNNPDDWKQYNVK------QKGDDFELTPK.SASGNLKQFAISVTPSGT-IKSFTAVEQDGQRSAYTLKSQQ-SSVVDASKFTFT
DSQ  AGTAAAGTGAATAGCTTCCATGCCAGCTTCTCGCAAGCTGTTACCAGTTCAGACGGGGCGGTAGTGCAGGAAGGTGAGGGCGAACTGTGGGTAAAACGTCCTAATTTGTTTAACTGGCATATGACATCACCGGATGAAAGCGTATTAATCTCTGATGGGGAAACTCTGTGGTTTTATAACCCATTTGTTGAACAAGCC......ACCGCCACTTGG......TTGAAGAATGCAACGGGTAATACACCGTTTATGTTGATTACT------CGCAACAACCCAGATGACTGGAAGCAATATAATGTTAAG------------------CAGAAAGGCGATGATTTTGAGCTGACACCTAAA...AGTGCTAGCGGCAATTTAAAGCAATTTGCGATAAGTGTGACGCCAAGCGGCACT---ATCAAAAGCTTTACTGCTGTTGAGCAAGATGGTCAACGCAGTGCTTATACACTGAAAAGCCAGCAA---AGTAGCGTGGTTGATGCCAGTAAGTTTACCTTTACT
TRN  10010101100011000
NAM  Q6D3U8_ERWCT/32-191
ASQ  NKVNSFHANFSQKVTSTDGAAVQEGEGELWLKRPNLFNWKTTSPDESALISDGKTLWFYNPFVEQV..TATW..LKDATGNTPFILIT--RNDTSDWNKYDVR------QKGDDFELTPK.SASGNLKQFAINVTTNGT-IKQFTATEQDGQRSTYVLRNQQ-NGVVDAAQFTFT
DSQ  AATAAAGTAAACAGTTTCCATGCGAACTTCAGCCAGAAAGTAACTAGCACCGATGGTGCAGCGGTGCAGGAAGGGGAAGGCGAACTGTGGTTGAAACGCCCTAACTTATTTAACTGGAAAACCACGTCGCCTGATGAAAGTGCGTTGATTTCTGACGGTAAAACACTTTGGTTTTACAACCCGTTTGTTGAACAAGTC......ACGGCAACCTGG......CTGAAAGATGCAACAGGAAATACGCCGTTCATTCTGATTACG------CGTAACGATACCAGCGATTGGAATAAATACGATGTGCGT------------------CAGAAAGGCGATGATTTTGAACTTACGCCGAAG...TCAGCGAGCGGCAATCTGAAGCAGTTCGCGATTAATGTGACGACAAACGGCACG---ATCAAGCAGTTTACCGCGACGGAACAGGATGGGCAGCGGAGCACTTATGTGCTGAGGAACCAGCAA---AACGGCGTGGTGGATGCTGCGCAATTCACTTTCACA
TRN  10010101100011000
NAM  LOLA_ECO57/32-191
ASQ  DKVSSFHASFTQKVTDGSGAAVQEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQA..TATW..LKDATGNTPFMLIA--RNQSSDWQQYNIK------QNGDDFVLTPK.ASNGNLKQFTINVGRDGT-IHQFSAVEQDDQRSSYQLKSQQ-NGAVDAAKFTFT
NAM  LOLA_BORPE/38-200
ASQ  ATVKGATGSFKQSTVSPQGATQPAQSGTFAFQRPGKFKWAVQLPYEQLIVSDGKQVFQYDPDLAQV..TVRQ..VDQAIGTSPAAILF---GAGQLSQAFAVS-ALPDRDGLQWLRAKPR.NADAGFSQVDIGLRDNQ--PARIELVDAFGQTTRVELSNLL-PGAVPASEFQFT
DSQ  GCCACCGTCAAGGGCGCCACCGGCTCGTTCAAGCAATCGACCGTCAGCCCGCAGGGCGCCACCCAGCCCGCGCAAAGCGGCACTTTCGCGTTCCAGCGCCCGGGCAAGTTCAAGTGGGCCGTCCAGCTGCCGTACGAGCAACTCATCGTGTCCGATGGCAAGCAGGTTTTCCAGTACGACCCGGACCTGGCGCAGGTC......ACCGTGCGCCAG......GTCGATCAGGCCATCGGCACGTCGCCCGCCGCCATCCTGTTC---------GGCGCGGGCCAGCTGAGCCAGGCGTTTGCCGTCAGC---GCGCTGCCCGACCGCGACGGCCTGCAATGGCTGCGCGCCAAGCCGCGC...AACGCCGACGCGGGTTTCTCGCAGGTCGATATCGGCTTGCGCGACAACCAG------CCCGCGCGCATCGAACTGGTCGACGCCTTCGGGCAGACCACGCGCGTCGAGCTGTCCAACCTGCTG---CCCGGCGCCGTGCCGGCCTCCGAATTCCAGTTCACC
TRN  11011111101111111
NAM  LOLA_XANCP/32-197
ASQ  RGLKGLDGQFSQRVTDANGRVKENSSGRVALATPRQFRWEYAKPYKQLIVADGKKVWVFDPDLEQV..TVRA..QGSEEQNSPLVALI---DPTRLDKQYDVSEEAAPRDGLQWLSLTPKvDTDASFQMASLGFGKDG--LAKMEVVDAVGQRTAISFSGWKRNPAFAADTFRYT
DSQ  CGTGGCTTGAAGGGGCTGGATGGACAGTTCAGCCAGCGCGTGACCGACGCGAATGGTCGGGTCAAGGAAAATTCAAGCGGGCGGGTTGCGTTGGCAACACCGCGCCAGTTCCGTTGGGAATATGCCAAGCCCTACAAGCAGTTGATCGTGGCCGATGGCAAGAAGGTCTGGGTGTTCGACCCCGATCTGGAGCAGGTC......ACCGTGCGCGCA......CAAGGCAGCGAAGAACAGAACAGCCCGCTGGTGGCATTGATC---------GATCCGACGCGCCTGGACAAGCAGTACGACGTCAGCGAAGAAGCCGCGCCGCGCGATGGGCTGCAGTGGTTGTCGTTGACGCCCAAGgtcGACACCGACGCCAGCTTCCAGATGGCCTCGCTGGGGTTCGGCAAGGACGGC------CTGGCCAAGATGGAAGTCGTGGATGCAGTCGGCCAGCGCACCGCGATCAGCTTCAGCGGGTGGAAGCGCAACCCCGCATTCGCGGCCGACACTTTCCGTTACACC
TRN  11011111101111101
NAM  LOLA_XYLFA/34-199
ASQ  RGLKTLQGHFSQEIIDTQGRVKERSNGTVALSLPNLLRWECDAPYKQLVVADGKRVWLFDPDLNQA..SVRL..QGNEERNSPLIALI---DPIQLDLKYDVSEEVAMRDGLRWLSLRPRvGIEASFQSASFGFAQTQ--LARMELVDNLGQRTVIVFSGWQRNPVFAVDTFRFT
NAM  LOLA_NITEU/32-196
ASQ  NKALTFQANFSQTLLDKNFQVIRKASGSMMFERPGKFRWTYDQPYQQLIVGDGKQVWFYDQDLAQV..TVHR..LDQALGSTPAALLA---GGNTIERDFNLQ-EIDVQGETEWLEAIPK.NQENSFELIRLGFSKTGI-LREMVLRDSFDQVTWLIFSEIEQNPTLTPDLFQFT
DSQ  AATAAGGCACTGACTTTCCAGGCCAATTTTTCCCAAACGTTGCTGGATAAGAACTTCCAGGTTATCAGAAAAGCCAGTGGCAGCATGATGTTCGAACGCCCTGGCAAATTCCGCTGGACATACGATCAGCCTTATCAACAGCTGATCGTCGGCGATGGTAAACAGGTATGGTTTTATGATCAGGATCTTGCTCAGGTC......ACGGTACATCGG......CTCGATCAGGCTTTGGGCAGCACTCCGGCAGCGCTGCTCGCA---------GGGGGCAATACCATTGAACGCGACTTTAACCTGCAG---GAAATCGACGTACAGGGAGAAACAGAATGGCTGGAAGCGATTCCCAAG...AATCAGGAAAACTCGTTTGAGCTGATCCGGCTGGGATTTTCAAAAACAGGCATT---TTACGTGAGATGGTTTTGCGCGACAGCTTCGATCAGGTAACGTGGCTGATTTTTTCCGAAATCGAACAAAACCCGACACTCACACCCGATCTGTTCCAGTTTACG
TRN  10010101100011000
NAM  LOLA_CHRVO/34-195
ASQ  SGSKTLSADFNQTVTNKGKR--EEASGRLEIARPGKFRWEYTKPYAQLIVGDGKTLWIYDQDLAQV..TRKA..QGAALGSSPAALLA---GNNEIERSYKLN-EAGKQGDLEWLAASPK.KQDNTFSAIRMGF-KNNV-LVEMQLTDSFGNDTRIVFSQQRQNAALPPARFAFA
DSQ  TCCGGCAGCAAGACCCTGTCGGCAGATTTCAACCAGACCGTGACCAACAAGGGCAAGCGC------GAAGAGGCCAGCGGCCGGCTGGAGATCGCCCGCCCGGGGAAATTCCGCTGGGAATACACCAAACCCTACGCCCAACTGATCGTCGGCGACGGCAAGACGCTGTGGATCTACGACCAGGACCTCGCCCAGGTA......ACCCGCAAGGCC......CAGGGCGCCGCGCTGGGCTCCAGCCCGGCCGCGCTGCTGGCC---------GGCAACAATGAAATCGAGCGCAGCTACAAGCTGAAC---GAGGCCGGCAAGCAGGGCGACCTGGAATGGCTGGCCGCCAGCCCGAAA...AAGCAGGACAACACCTTCAGCGCCATCCGCATGGGCTTC---AAGAACAATGTG---CTGGTGGAAATGCAGCTGACCGACAGCTTCGGCAACGACACCCGCATCGTGTTCAGCCAGCAGCGGCAGAACGCCGCGCTGCCGCCCGCCCGCTTCGCCTTCGCT
TRN  11011101101011011
NAM  LOLA_NEIMA/36-197
ASQ  NDADGISGSFTQTVQSKKKT--QTAHGTFKILRPGLFKWEYTSPYKQTIVGDGQTVWLYDVDLAQV..TKSS..QDQAIGGSPAAILS---NKTALESSYTLK-EDGSSNGIDYVLATPK.RNNAGYQYIRIGF-KGGN-LAAMQLKDSFGNQTSISFGGLNTNPQLSRGAFKFT
DSQ  AACGATGCCGACGGTATCAGCGGCAGCTTCACCCAAACCGTCCAAAGCAAAAAGAAAACC------CAAACCGCGCACGGCACGTTCAAAATCCTGCGCCCGGGCCTCTTTAAATGGGAATACACTTCGCCTTACAAACAGACTATTGTCGGCGACGGTCAAACCGTTTGGCTCTACGATGTCGATTTGGCACAAGTG......ACCAAGTCGTCC......CAAGACCAGGCCATAGGCGGCAGCCCCGCCGCCATCCTGTCG---------AACAAAACCGCCCTCGAAAGCAGCTACACGCTGAAA---GAGGACGGTTCGTCCAACGGCATCGATTATGTGCTGGCAACGCCCAAA...CGCAACAACGCCGGCTACCAATACATCCGCATCGGCTTC---AAAGGCGGCAAC---CTCGCCGCCATGCAGCTTAAAGACAGCTTCGGCAATCAAACCTCCATCAGTTTCGGCGGTTTGAATACCAATCCCCAACTCTCGCGCGGCGCGTTCAAGTTTACC
TRN  10010101100011011
NAM  LOLA_PSEPK/34-197
ASQ  EKSQTIEANFSQLTLGADGTSLQETSGKMTVKRPGLFYWHTDAPQEQVVVSDGKNVTLWDPDLEQA..TIKK..LDVRLNQTPALLLS--GDVSKISQSFDIA--SKEQGEVMDFTLKPK.TKDTLFDSLRVSF-RKGL-INDMQLIDSVGQRTNILFNGVKANQAVPDSKFKFD
NAM  LOLA_PSESY/34-197
ASQ  EKSQTLTARFSQLTLDGGGTQLQETTGEMALQRPGLFNWHTDAPQEQLMVSDGKKVSLWDPDLEQV..TIKK..LDQRLTQTPALLLS--GDVSKISESFDIT--AKEAGGVIDFTLKPK.TKDTLFDSLRLSF-RNGI-INDMQLIDSVGQRTNILFTGVKANESIAASKFQFQ
DSQ  GAGAAATCCCAGACCCTGACCGCCCGCTTCTCGCAACTGACGCTGGATGGTGGCGGTACCCAGTTGCAGGAAACCACCGGCGAAATGGCCCTGCAGCGCCCCGGCTTGTTCAACTGGCACACCGATGCGCCACAGGAACAGTTGATGGTCTCGGACGGCAAGAAAGTTTCGCTGTGGGACCCTGATCTGGAGCAGGTC......ACGATCAAGAAA......CTCGATCAGCGCCTGACCCAGACTCCAGCCTTGCTGCTGTCC------GGTGACGTATCGAAGATCAGCGAAAGCTTCGACATCACC------GCGAAAGAAGCAGGTGGCGTGATCGATTTCACGCTCAAGCCCAAA...ACCAAGGACACGCTGTTCGACAGCCTGCGCCTGTCGTTT---CGCAACGGCATC---ATCAACGACATGCAGTTGATCGACAGCGTCGGGCAGCGCACCAATATCCTGTTCACCGGGGTCAAGGCCAACGAGTCGATCGCAGCCAGCAAGTTTCAGTTCCAG
TRN  11011101101011011
NAM  LOLA_PSEAE/35-198
ASQ  NKAQTLTARFSQLTLDGSGTRLQETAGQLSLKRPGLFRWHTDAPNEQLLISNGEKVWLYDPDLEQV..TIQK..LDQRLTQTPALLLS--GDISKISESFAIT--YKEGGNVVDFVLKPK.TKDTLFDTLRLSF-RSGK-VNDMQMIDGVGQRTNILFFDVKMNEALDAKQFTFD
DSQ  AACAAGGCCCAGACCCTGACCGCGCGTTTTTCCCAGCTGACCCTGGACGGTAGCGGCACGCGCCTGCAGGAAACCGCCGGCCAACTGAGCCTGAAGCGGCCGGGACTGTTCCGCTGGCATACCGATGCGCCGAACGAGCAATTGCTCATTTCCAACGGCGAGAAGGTCTGGCTGTACGACCCGGACCTGGAGCAGGTG......ACCATCCAGAAG......CTCGATCAGCGCCTGACCCAGACGCCGGCGCTGCTGCTCTCC------GGCGACATCTCGAAGATCAGCGAAAGCTTCGCCATCACC------TACAAGGAAGGCGGCAACGTAGTCGATTTCGTGCTCAAGCCGAAG...ACCAAGGACACCCTCTTCGACACCTTGCGCCTGTCGTTC---CGCAGCGGCAAG---GTGAACGACATGCAGATGATCGATGGCGTCGGCCAGCGCACCAACATCCTGTTCTTCGACGTGAAGATGAACGAGGCGCTGGATGCCAAGCAATTCACCTTCGAC
TRN  11011111101111111
NAM  LOLA_COXBU/37-201
ASQ  SNFRTYQAKFNQITFDGQDRVIQQSHGRVMIMRPGRFRWETDSPTKQIIITNGKTLWVYDVDLSQA..TQQP..LAQKTNINPASLLS--GSVKDLKQKFTIT--ISPTPDAATFQLVPNlGKSLNFNWIRLKFSKKQ--LTEMTVLNNLDERSIFQFSQIKVNAPLSSTLFEFK
DSQ  TCAAATTTTCGAACTTATCAGGCAAAATTTAATCAAATTACTTTTGATGGCCAAGATCGAGTGATCCAACAAAGCCATGGACGGGTCATGATTATGCGCCCGGGGCGCTTTCGCTGGGAAACCGATTCACCGACTAAACAAATTATAATCACAAACGGAAAAACGTTGTGGGTGTATGATGTAGACTTGTCGCAAGCC......ACACAGCAGCCA......CTAGCGCAAAAAACGAATATTAATCCTGCTTCGTTATTGTCG------GGGTCGGTGAAAGATCTAAAACAAAAATTCACCATTACG------ATTAGCCCAACTCCTGATGCCGCCACTTTTCAATTGGTTCCCAACttaGGGAAAAGCCTTAATTTTAATTGGATTCGTTTAAAATTTTCAAAAAAGCAA------CTTACCGAAATGACCGTATTAAATAATTTGGATGAAAGAAGTATTTTCCAATTCAGCCAAATTAAGGTAAACGCTCCATTGTCGAGTACGCTTTTTGAATTTAAG
TRN  10010101110011000
//