EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03539 - Spuma_A9PTase)
FAM  PF03539
PID  Spuma_A9PTase
DES  Spumavirus aspartic protease (A9)
IPR  IPR001641
ANO  5
ALN  163
AID  0.591805
APH  (((Q9J4C7_9RETR/11-173:0.28743,O41894_9RETR/11-173:0.29452):0.10364,O93209_9RETR/11-173:0.33421):0.29155,GAG_FOAMV/645-807:0.16579,POL_SFV1/26-188:0.08835);
ATP  (((Q9J4C7_9RETR/11-173,O41894_9RETR/11-173),O93209_9RETR/11-173),GAG_FOAMV/645-807,POL_SFV1/26-188);
ATL  1.56549
DNO  5
DLN  489
DID  0.633538
DPH  (((Q9J4C7_9RETR/11-173:0.24371,O41894_9RETR/11-173:0.27893):0.05496,O93209_9RETR/11-173:0.24250):0.18731,GAG_FOAMV/645-807:0.16575,POL_SFV1/26-188:0.13327);
DTP  (((Q9J4C7_9RETR/11-173,O41894_9RETR/11-173),O93209_9RETR/11-173),GAG_FOAMV/645-807,POL_SFV1/26-188);
DTL  1.30643
RID  0.591805
RPH  (((Q9J4C7_9RETR/11-173:0.28743,O41894_9RETR/11-173:0.29452):0.10364,O93209_9RETR/11-173:0.33421):0.29155,GAG_FOAMV/645-807:0.16579,POL_SFV1/26-188:0.08835);
RTP  (((Q9J4C7_9RETR/11-173,O41894_9RETR/11-173),O93209_9RETR/11-173),GAG_FOAMV/645-807,POL_SFV1/26-188);
RTL  1.56549
LNK  GAG_FOAMV/645-807:P14349:M19427
LNK  O41894_9RETR/11-173:O41894:U94514
LNK  O93209_9RETR/11-173:O93209:AJ223851
LNK  POL_SFV1/26-188:P23074:X58484
LNK  Q9J4C7_9RETR/11-173:Q9J4C7:AF201902
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  POL_SFV1/26-188
ASQ  IKGTKLKAHWDSGATITCVPEAFLEDERPIQTMLIKTIHGEKQQDVYYLTFKVQGRKVEAEVLASPYDYILLNPSDVPWLMKKPLQLTVLVPLHEYQERLLQQTALPKEQKELLQKLFLKYDALWQHWENQVGHRRIKPHNIATGTLAPRPQKQYPINPKAKP
DSQ  ATCAAGGGAACTAAATTAAAAGCCCACTGGGATAGTGGAGCTACAATTACCTGTGTTCCAGAAGCGTTTCTTGAAGATGAACGACCGATACAAACTATGTTAATTAAGACTATACATGGGGAAAAACAACAAGATGTTTATTATCTGACTTTTAAAGTCCAAGGAAGAAAAGTGGAAGCAGAAGTACTCGCCTCCCCTTATGACTATATCTTACTAAATCCATCAGATGTCCCTTGGCTCATGAAAAAACCTTTACAGTTGACTGTATTAGTTCCTCTTCATGAATATCAAGAGAGACTTTTACAACAGACAGCCTTGCCAAAAGAGCAGAAAGAATTATTACAAAAATTATTTTTAAAGTATGATGCACTTTGGCAGCATTGGGAAAATCAAGTAGGACATAGGAGAATTAAACCACATAACATTGCAACTGGTACATTGGCTCCTAGGCCACAAAAACAATATCCAATAAATCCAAAGGCTAAGCCT
TRN  10010101100011000
NAM  GAG_FOAMV/645-807
ASQ  IKGTKLLAHWDSGATITCIPESFLEDEQPIKKTLIKTIHGEKQQNVYYVTFKVKGRKVEAEVIASPYEYILLSPTDVPWLTQQPLQLTILVPLQEYQEKILSKTALPEDQKQQLKTLFVKYDNLWQHWENQVGHRKIRPHNIATGDYPPRPQKQYPINPKAKP
DSQ  ATCAAAGGGACTAAATTGTTAGCCCACTGGGATTCAGGGGCAACAATAACTTGTATTCCTGAAAGTTTTTTAGAAGATGAACAACCTATTAAAAAGACTTTAATAAAAACAATTCATGGAGAAAAACAACAAAATGTTTATTATGTAACCTTTAAAGTTAAAGGAAGAAAAGTGGAAGCAGAAGTGATAGCTTCTCCTTATGAGTATATTTTGCTGTCGCCAACAGATGTTCCTTGGTTAACACAGCAACCACTTCAGTTAACAATTTTAGTTCCTCTTCAAGAATATCAAGAGAAAATCTTAAGTAAGACTGCTCTTCCAGAAGATCAAAAACAACAATTAAAAACCTTGTTTGTCAAGTATGACAATCTATGGCAACATTGGGAAAATCAAGTCGGGCATAGAAAAATTAGGCCACATAATATAGCAACTGGTGATTATCCTCCTCGCCCTCAAAAACAATATCCTATTAATCCTAAGGCAAAGCCA
TRN  10010101100011000
NAM  Q9J4C7_9RETR/11-173
ASQ  IKGNSLKGFYDTGAEITCVPAIFLIEEEPIGERTIQTIHGITKEKVYYLTFKIQGRKLAAEVIGTQLDYVIIAPSDIPWYKKYELELTIKIDIQKQQEQLLHTTNLSSEGKKYLKDLFIKYDNLWQKWENQVGHRRITPHKIATGTLNPKPQKQYRINPKAKA
DSQ  ATCAAGGGCAACAGCCTTAAGGGATTTTATGATACAGGAGCTGAAATAACTTGTGTCCCTGCGATATTCCTTATAGAAGAAGAACCAATAGGAGAAAGAACTATTCAAACTATACACGGTATAACAAAAGAGAAAGTATACTATTTAACATTTAAAATACAAGGAAGAAAATTAGCAGCTGAGGTAATAGGGACACAATTGGACTATGTAATTATAGCACCCTCAGATATTCCTTGGTATAAAAAATATGAATTAGAATTGACTATTAAGATAGATATACAAAAACAACAAGAACAATTACTTCACACTACTAATTTGTCATCTGAAGGGAAGAAATATTTAAAGGACCTCTTTATTAAATATGATAATTTGTGGCAGAAATGGGAAAATCAAGTGGGACATAGAAGAATTACTCCACATAAGATTGCTACTGGCACTCTCAATCCCAAGCCTCAAAAACAATATAGGATTAATCCTAAAGCTAAAGCA
TRN  10010101110011000
NAM  O41894_9RETR/11-173
ASQ  IKGNHLKGYWDSGAEITCVPAIYIIEEQPVGKKLITTIHNEKEHDVYYVEMKIEKRKVQCEVIATALDYVLVAPVDIPWYKPGPLELTIKIDVESQKHTLITESTLSPQGQMRLKKLLDQYQALWQCWENQVGHRRIEPHKIATGALKPRPQKQYHINPRAKA
DSQ  ATCAAGGGCAATCATCTTAAAGGCTACTGGGACTCTGGGGCTGAAATCACTTGTGTCCCAGCCATATATATAATAGAAGAACAACCAGTGGGAAAAAAACTGATTACTACCATACATAATGAAAAAGAACATGATGTGTATTACGTGGAGATGAAGATCGAGAAGAGAAAAGTACAATGTGAAGTAATAGCTACTGCCCTGGACTATGTATTGGTAGCTCCTGTCGATATTCCCTGGTATAAACCAGGACCACTGGAGCTGACTATTAAAATAGATGTGGAATCCCAAAAACACACCCTGATAACTGAAAGCACCTTATCTCCTCAAGGCCAGATGAGATTAAAAAAACTGTTGGATCAATACCAAGCTCTATGGCAATGTTGGGAAAACCAGGTCGGACATCGGCGTATTGAGCCACATAAGATAGCCACTGGGGCCTTGAAACCTCGACCTCAAAAACAATATCATATAAATCCAAGGGCAAAAGCA
TRN  10010101100011010
NAM  O93209_9RETR/11-173
ASQ  RKGVKIKGYWDSQADITCVPKDLLQGEEPVRQQNVTTIHGTQEGDVYYVNLKIDGRRINTEVIGTTLDYAIITPGDVPWILKKPLELTIKLDLEEQQGTLLNNSILSKKGKEELKQLFEKYSALWQSWENQVGHRRIRPHKIATGTVKPTPQKQYHINPKAKP
DSQ  AGAAAGGGGGTAAAGATTAAAGGTTACTGGGACTCCCAAGCCGATATTACCTGTGTTCCAAAGGACTTGCTTCAAGGAGAAGAACCTGTTAGGCAGCAAAATGTGACTACTATACATGGAACGCAGGAAGGAGATGTATATTATGTAAATTTAAAAATAGACGGTAGAAGAATTAATACAGAAGTAATAGGGACAACTTTGGACTATGCTATTATAACTCCTGGAGATGTACCTTGGATTTTGAAGAAACCTCTAGAATTGACTATTAAACTAGATTTAGAAGAGCAGCAAGGGACTTTACTTAACAATTCCATTTTATCTAAAAAAGGGAAAGAAGAATTAAAACAATTATTTGAGAAATATAGTGCCTTATGGCAAAGTTGGGAGAATCAGGTGGGTCATAGAAGAATTAGGCCACATAAAATAGCAACTGGTACAGTAAAACCCACACCTCAGAAACAGTATCATATTAATCCAAAGGCAAAACCT
TRN  10010101110011010
//