EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03522 - KCl_Cotrans_1)
FAM  PF03522
PID  KCl_Cotrans_1
DES  K-Cl Co-transporter type 1 (KCC1)
IPR  IPR000622
ANO  3
ALN  30
AID  0.563218
APH  (S12A6_HUMAN/1018-1047:0.15200,Q98SU0_XENLA/229-258:0.16736,O18887_PIG/953-982:0.70267);
ATP  (S12A6_HUMAN/1018-1047,Q98SU0_XENLA/229-258,O18887_PIG/953-982);
ATL  1.02203
DNO  3
DLN  90
DID  0.644444
DPH  (S12A6_HUMAN/1018-1047:0.17632,Q98SU0_XENLA/229-258:0.18621,O18887_PIG/953-982:0.40982);
DTP  (S12A6_HUMAN/1018-1047,Q98SU0_XENLA/229-258,O18887_PIG/953-982);
DTL  0.77235
RID  0.563218
RPH  (S12A6_HUMAN/1018-1047:0.15200,Q98SU0_XENLA/229-258:0.16736,O18887_PIG/953-982:0.70267);
RTP  (S12A6_HUMAN/1018-1047,Q98SU0_XENLA/229-258,O18887_PIG/953-982);
RTL  1.02203
LNK  O18887_PIG/953-982:O18887:AF028807
LNK  Q98SU0_XENLA/229-258:Q98SU0:AF325505
LNK  S12A6_HUMAN/1018-1047:Q9UHW9:AF116242
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  S12A6_HUMAN/1018-1047
ASQ  VKDRNSMLRLTSIGSDEDEETETYQEKVHM
DSQ  GTGAAAGACCGAAACTCAATGCTACGATTGACCAGCATTGGCTCTGATGAGGACGAAGAGACAGAAACCTATCAGGAGAAGGTGCACATG
TRN  11011101111011001
NAM  Q98SU0_XENLA/229-258
ASQ  VKDRNSILRLTSVGSDDDEDTEAAPERVHM
DSQ  GTGAAGGACAGGAATTCAATCCTGCGTTTAACCAGTGTGGGCTCTGATGATGATGAAGATACAGAGGCTGCCCCAGAGAGAGTACATATG
TRN  10010101100011000
NAM  O18887_PIG/953-982
ASQ  VKDRHSALRLESLYSDEEDESVAGTDKIQM
DSQ  GTCAAGGACCGGCACTCAGCCCTGCGGCTGGAGAGCCTGTACTCAGATGAGGAGGACGAGTCTGTAGCTGGGACTGACAAGATCCAGATG
TRN  11011111101111101
//