EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03520 - KCNQ_channel)
FAM  PF03520
PID  KCNQ_channel
DES  KCNQ voltage-gated potassium channel
IPR  IPR003937
ANO  2
ALN  242
AID  0.663594
APH  (KCNQ1_SQUAC/410-645:0.09681,KCNQ1_MOUSE/418-655:0.35605);
ATP  (KCNQ1_SQUAC/410-645,KCNQ1_MOUSE/418-655);
ATL  0.45287
DNO  2
DLN  726
DID  0.650862
DPH  (KCNQ1_SQUAC/410-645:0.45632,KCNQ1_MOUSE/418-655:0.02042);
DTP  (KCNQ1_SQUAC/410-645,KCNQ1_MOUSE/418-655);
DTL  0.47673
RID  0.663594
RPH  (KCNQ1_SQUAC/410-645:0.09681,KCNQ1_MOUSE/418-655:0.35605);
RTP  (KCNQ1_SQUAC/410-645,KCNQ1_MOUSE/418-655);
RTL  0.45286
LNK  KCNQ1_MOUSE/418-655:P97414:AY331142
LNK  KCNQ1_SQUAC/410-645:O73925:AJ223714
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  KCNQ1_SQUAC/410-645
ASQ  KRKKLKTDKDNGLN-SEKSLNVPNITYDHVVDKDDRKFENSNIDGYDSSVKKSLGILDVNSGALSRANSYADDLDFIEGEPVLAPITHVSQLRESHRVTVKVIRRMQYFVAKKKFQQARKPYDVRDVIEQYSQGHLNLMVRIKELQRRLDQSLGKPTMFLSVSEKSQDRGKNTIGARLNRVEEKFVHMDQKLNTITDMLHHLVAHQQGHPHPQTQPQAQ-----GTVVQAVASTHSSLPSYE
DSQ  AAAAGAAAGAAGCTCAAGACTGATAAAGACAATGGATTGAAC---TCTGAGAAGTCACTGAATGTGCCGAACATCACTTACGACCATGTCGTTGACAAGGATGACAGGAAATTTGAAAACTCAAATATCGATGGATATGATTCATCAGTGAAGAAATCCCTGGGGATACTTGATGTGAACAGTGGAGCCTTGTCGAGAGCAAACAGCTATGCAGATGACCTTGACTTCATCGAGGGAGAGCCGGTACTGGCCCCTATCACACACGTTTCGCAGCTGAGGGAGTCCCACAGGGTCACCGTCAAGGTGATTCGCAGGATGCAGTATTTCGTAGCAAAGAAGAAATTTCAGCAAGCCAGAAAGCCTTACGATGTCAGAGATGTAATCGAGCAGTATTCTCAGGGTCATCTCAACTTGATGGTGCGAATCAAGGAATTGCAGAGAAGACTAGACCAGTCCTTAGGAAAACCAACGATGTTCCTATCTGTCTCAGAAAAGAGCCAGGACAGGGGGAAGAACACAATTGGAGCTAGACTTAATAGAGTAGAAGAGAAGTTTGTACACATGGATCAGAAGTTAAACACCATCACAGATATGCTGCACCATCTGGTTGCCCACCAGCAAGGACATCCGCACCCGCAGACTCAGCCTCAGGCACAG---------------GGAACCGTCGTACAAGCCGTTGCGTCGACACACAGCTCCCTGCCCAGCTACGAG
TRN  10010101100011000
NAM  KCNQ1_MOUSE/418-655
ASQ  KKKKFKLDKDNGMSPGEKMFNVPHITYD---PPEDRRPDHFSIDGYDSSVRKSPTLLELSTPHFLRTNSFAEDLD-LEGETLLTPITHVSQLRDHHRATIKVIRRMQYFVAKKKFQQARKPYDVRDVIEQYSQGHLNLMVRIKELQRRLDQSIGKPSLFIPISEKSKDRGSNTIGARLNRVEDKVTQLDQRLVIITDMLHQLLSMQQGGPTCNSRSQVVASNEGGSINPELFLPSNSLPTYE
DSQ  AAGAAGAAGAAGTTCAAGCTGGATAAGGATAATGGGATGAGTCCTGGAGAGAAGATGTTCAATGTTCCTCACATCACTTATGAT---------CCCCCAGAGGATAGGAGGCCAGACCATTTCTCCATTGATGGCTATGACAGCTCAGTAAGGAAGAGCCCTACACTGCTGGAATTAAGCACACCCCATTTCTTGAGAACAAACAGCTTTGCAGAGGACCTGGAC---CTGGAAGGGGAGACACTGCTGACCCCCATCACCCATGTGTCACAGCTGCGGGATCACCATCGGGCCACCATCAAGGTCATCAGGCGCATGCAGTACTTTGTAGCCAAGAAGAAATTCCAGCAAGCACGGAAGCCCTACGACGTGCGAGATGTCATCGAGCAGTACTCCCAGGGCCACCTGAACCTTATGGTGCGCATTAAAGAACTACAGAGAAGGCTGGATCAGTCCATTGGGAAGCCATCTTTGTTCATCCCCATCTCAGAAAAGAGCAAAGACCGTGGCAGTAACACCATCGGTGCCCGTCTGAACAGGGTGGAAGACAAGGTGACACAACTGGACCAGAGACTGGTGATCATCACAGACATGCTCCACCAGCTGCTGTCCATGCAACAAGGTGGTCCAACCTGCAACAGCAGGTCACAAGTTGTAGCCAGCAATGAAGGTGGCTCCATCAACCCTGAGCTCTTCCTACCCAGCAACAGCCTGCCCACCTACGAA
TRN  10010101100011000
//