EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03517 - ICln_channel)
FAM  PF03517
PID  ICln_channel
DES  Nucleotide-sensitive chloride conductance regulator (ICln)
IPR  IPR003521
ANO  5
ALN  85
AID  0.484744
APH  (((Q9LVA7_ARATH/46-120:0.98308,Q17564_CAEEL/29-107:0.47233):0.34344,ICLN_XENLA/30-111:0.11646):0.06839,ICLN_MOUSE/32-107:0.19355,P79725_BRARE/30-111:0.35011);
ATP  (((Q9LVA7_ARATH/46-120,Q17564_CAEEL/29-107),ICLN_XENLA/30-111),ICLN_MOUSE/32-107,P79725_BRARE/30-111);
ATL  2.52736
DNO  5
DLN  255
DID  0.52649
DPH  (((Q9LVA7_ARATH/46-120:0.67355,Q17564_CAEEL/29-107:0.32495):0.25198,ICLN_XENLA/30-111:0.13422):0.10730,ICLN_MOUSE/32-107:0.16872,P79725_BRARE/30-111:0.31316);
DTP  (((Q9LVA7_ARATH/46-120,Q17564_CAEEL/29-107),ICLN_XENLA/30-111),ICLN_MOUSE/32-107,P79725_BRARE/30-111);
DTL  1.97388
RID  0.484744
RPH  (((Q9LVA7_ARATH/46-120:0.98308,Q17564_CAEEL/29-107:0.47233):0.34344,ICLN_XENLA/30-111:0.11646):0.06839,ICLN_MOUSE/32-107:0.19355,P79725_BRARE/30-111:0.35011);
RTP  (((Q9LVA7_ARATH/46-120,Q17564_CAEEL/29-107),ICLN_XENLA/30-111),ICLN_MOUSE/32-107,P79725_BRARE/30-111);
RTL  2.52736
LNK  ICLN_MOUSE/32-107:Q61189:U53455
LNK  ICLN_XENLA/30-111:P54106:L26449
LNK  P79725_BRARE/30-111:P79725:Y08484
LNK  Q17564_CAEEL/29-107:Q17564:Z68270
LNK  Q9LVA7_ARATH/46-120:Q9LVA7:AB019235
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  ICLN_XENLA/30-111
ASQ  LGPGTLYIAESRLSWLNGSG--LGFSLEYPSISLHAISRDTAAYPEEHLYVMVNSKLADKEDKEAHMADQEEEESEDDDD-DEEP
DSQ  CTCGGCCCTGGAACCCTTTATATTGCAGAGAGTCGCCTGTCATGGCTGAACGGTTCCGGC------CTTGGTTTCTCATTAGAATATCCATCAATCAGTCTCCATGCAATCTCCAGGGACACGGCTGCTTATCCTGAGGAGCATCTCTACGTCATGGTGAACTCCAAGCTCGCAGACAAAGAAGACAAGGAAGCTCATATGGCTGATCAGGAGGAAGAAGAGAGTGAGGATGATGACGAT---GATGAAGAACCT
TRN  10010101100011000
NAM  ICLN_MOUSE/32-107
ASQ  LGTGTLYIAESRLSWLDGSG--LGFSLEYPTISLHAVSRDPNAYPQEHLYVMVNAKLG--EESKEPPSD----EDEEDND-DIEP
DSQ  CTCGGCACCGGCACGCTTTACATCGCGGAGAGCCGCCTGTCCTGGTTAGATGGTTCGGGA------TTAGGATTCTCACTGGAATACCCCACCATTAGTTTACATGCGGTGTCCAGGGATCCAAACGCTTACCCTCAAGAGCATTTGTATGTTATGGTGAATGCCAAGCTTGGA------GAAGAATCAAAAGAACCTCCCTCTGAT------------GAAGATGAGGAAGACAATGAT---GATATTGAACCC
TRN  10010101100011000
NAM  P79725_BRARE/30-111
ASQ  LGLGTLFVAEAQLSWFDGSG--MGFCLEYPTISLHAISRDLSAFPEEHLYVMVNAKLDD-EGEAAPLEKDPDEEDEDEEDSDSES
DSQ  CTCGGATTGGGGACCCTGTTCGTAGCGGAGGCACAGCTGTCCTGGTTTGATGGATCAGGG------ATGGGTTTCTGTCTTGAATATCCGACCATCAGCCTCCACGCAATCTCACGAGATCTCAGCGCCTTTCCAGAAGAGCACCTGTATGTGATGGTCAATGCCAAACTGGACGAT---GAAGGGGAAGCAGCGCCGCTGGAGAAAGATCCAGATGAAGAAGATGAGGATGAAGAGGACAGTGATAGTGAAAGC
TRN  11011101101011001
NAM  Q17564_CAEEL/29-107
ASQ  LGNGTLYITDSAVIWISSAAGTKGFSVAYPAIVLHAISTDVSVFPSEHIFVMVDQRKSGLELAAAELED-----EESDDD-EEEP
DSQ  CTTGGAAACGGAACCCTTTACATTACCGATAGTGCAGTTATCTGGATCAGCTCGGCCGCTGGAACAAAAGGATTTTCGGTTGCCTATCCAGCAATTGTTCTTCATGCCATATCCACTGACGTCTCCGTTTTCCCATCAGAACACATATTTGTCATGGTTGATCAGCGGAAGTCAGGCTTGGAACTTGCTGCTGCAGAGCTCGAAGAC---------------GAAGAAAGTGATGATGAT---GAGGAAGAACCA
TRN  10010101110011001
NAM  Q9LVA7_ARATH/46-120
ASQ  ESPGTLYITSRKLIWLSDVDMAKGYAVDFLSISLHAVSRDPEAYSSPCIYTQIEVEED----EDDE-SD-----SESTEVLDLSK
DSQ  GAGTCTCCCGGAACTCTCTACATCACTTCCAGGAAATTAATTTGGCTGAGCGATGTAGACATGGCTAAAGGATACGCAGTTGATTTCTTATCAATATCGCTTCACGCTGTTTCTAGAGATCCTGAGGCTTATTCATCTCCTTGTATATATACTCAGATTGAAGTTGAAGAAGAT------------GAGGATGATGAG---TCTGAT---------------TCAGAATCCACTGAAGTTTTGGACTTATCAAAG
TRN  10010101100011000
//