EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03494 - Beta-APP)
FAM  PF03494
PID  Beta-APP
DES  Beta-amyloid peptide (beta-APP)
IPR  IPR001255
ANO  2
ALN  39
AID  0.763158
APH  (Q9I9E7_BRARE/517-555:0.18767,A4_SAISC/656-694:0.10484);
ATP  (Q9I9E7_BRARE/517-555,A4_SAISC/656-694);
ATL  0.29251
DNO  2
DLN  117
DID  0.666667
DPH  (Q9I9E7_BRARE/517-555:0.29268,A4_SAISC/656-694:0.15584);
DTP  (Q9I9E7_BRARE/517-555,A4_SAISC/656-694);
DTL  0.44852
RID  0.763158
RPH  (Q9I9E7_BRARE/517-555:0.18767,A4_SAISC/656-694:0.10484);
RTP  (Q9I9E7_BRARE/517-555,A4_SAISC/656-694);
RTL  0.29251
LNK  A4_SAISC/656-694:Q95241:S81024
LNK  Q9I9E7_BRARE/517-555:Q9I9E7:AF257742
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9I9E7_BRARE/517-555
ASQ  EAEERHSEVYHQKLVFFAEDVSSNKGAIIGLMVGGVVIA
DSQ  GAAGCTGAAGAGAGACACAGTGAAGTCTACCACCAGAAGCTGGTTTTCTTTGCGGAGGACGTGAGCTCCAATAAAGGAGCTATTATTGGCCTGATGGTCGGAGGCGTCGTCATAGCA
TRN  10010101100011011
NAM  A4_SAISC/656-694
ASQ  FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
DSQ  TTCCGACATGACTCAGGATATGAAGTTCATCATCAAAAACTGGTGTTCTTTGCAGAAGATGTGGGTTCAAACAAAGGCGCAATCATTGGACTCATGGTGGGCGGTGTTGTCATAGCA
TRN  10010101100011001
//