EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03468 - XS)
FAM  PF03468
PID  XS
DES  XS domain
IPR  IPR005380
ANO  9
ALN  122
AID  0.398648
APH  ((Q9M150_ARATH/28-146:0.44671,Q9LUV5_ARATH/52-162:1.38348):0.00000,(((Q9SBW2_ORYSA/111-225:0.20887,O48878_SORBI/85-199:0.07366):0.23295,(Q9SAI1_ARATH/114-228:0.24369,Q9S9P3_ARATH/114-228:0.30389):0.66249):0.15474,(Q9LHB1_ARATH/116-233:0.34776,Q9SMN2_ARATH/123-240:0.14840):0.19359):0.12398,Q9LMH6_ARATH/215-334:0.56557);
ATP  ((Q9M150_ARATH/28-146,Q9LUV5_ARATH/52-162),(((Q9SBW2_ORYSA/111-225,O48878_SORBI/85-199),(Q9SAI1_ARATH/114-228,Q9S9P3_ARATH/114-228)),(Q9LHB1_ARATH/116-233,Q9SMN2_ARATH/123-240)),Q9LMH6_ARATH/215-334);
ATL  5.08384
DNO  9
DLN  366
DID  0.505817
DPH  (((((Q9M150_ARATH/28-146:0.31537,Q9LMH6_ARATH/215-334:0.39854):0.06717,Q9LUV5_ARATH/52-162:0.80996):0.07433,(Q9LHB1_ARATH/116-233:0.23438,Q9SMN2_ARATH/123-240:0.11976):0.17539):0.14189,(Q9SBW2_ORYSA/111-225:0.08912,O48878_SORBI/85-199:0.08601):0.19031):0.45574,Q9SAI1_ARATH/114-228:0.20293,Q9S9P3_ARATH/114-228:0.15415);
DTP  (((((Q9M150_ARATH/28-146,Q9LMH6_ARATH/215-334),Q9LUV5_ARATH/52-162),(Q9LHB1_ARATH/116-233,Q9SMN2_ARATH/123-240)),(Q9SBW2_ORYSA/111-225,O48878_SORBI/85-199)),Q9SAI1_ARATH/114-228,Q9S9P3_ARATH/114-228);
DTL  3.51505
RID  0.398648
RPH  ((Q9M150_ARATH/28-146:0.44671,Q9LUV5_ARATH/52-162:1.38348):0.00000,(((Q9SBW2_ORYSA/111-225:0.20887,O48878_SORBI/85-199:0.07366):0.23295,(Q9SAI1_ARATH/114-228:0.24369,Q9S9P3_ARATH/114-228:0.30389):0.66249):0.15474,(Q9LHB1_ARATH/116-233:0.34776,Q9SMN2_ARATH/123-240:0.14840):0.19359):0.12398,Q9LMH6_ARATH/215-334:0.56557);
RTP  ((Q9M150_ARATH/28-146,Q9LUV5_ARATH/52-162),(((Q9SBW2_ORYSA/111-225,O48878_SORBI/85-199),(Q9SAI1_ARATH/114-228,Q9S9P3_ARATH/114-228)),(Q9LHB1_ARATH/116-233,Q9SMN2_ARATH/123-240)),Q9LMH6_ARATH/215-334);
RTL  5.08384
LNK  O48878_SORBI/85-199:O48878:AF010283
LNK  Q9LHB1_ARATH/116-233:Q9LHB1:AP002055
LNK  Q9LMH6_ARATH/215-334:Q9LMH6:AC068197
LNK  Q9LUV5_ARATH/52-162:Q9LUV5:AB022215
LNK  Q9M150_ARATH/28-146:Q9M150:AL161491
LNK  Q9S9P3_ARATH/114-228:Q9S9P3:AC010924
LNK  Q9SAI1_ARATH/114-228:Q9SAI1:AC011713
LNK  Q9SBW2_ORYSA/111-225:Q9SBW2:AF101045
LNK  Q9SMN2_ARATH/123-240:Q9SMN2:AL133315
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9LUV5_ARATH/52-162
ASQ  QAQLIIWPPHVIVQNTSTGKGKEGRM-EGF-GNKTMDNRIRELGLTGGKSKSLYG.REGHLGITLFKFAGDDSGLRDAMRMAEYFEKINRGRKSWGRVQ--------PLTPSKDDEKNPGLV
DSQ  CAAGCCCAGCTAATTATTTGGCCACCTCATGTTATTGTTCAGAATACCAGTACAGGGAAGGGAAAAGAAGGGCGCATG---GAAGGCTTT---GGAAACAAAACAATGGATAACAGAATTAGAGAACTAGGACTCACTGGTGGGAAATCGAAGTCGTTGTATGGA...AGAGAGGGTCATTTGGGAATTACCCTGTTCAAGTTTGCTGGAGACGATTCAGGGCTCAGGGATGCTATGAGAATGGCAGAATATTTTGAGAAGATAAACCGTGGGCGTAAGAGTTGGGGGAGGGTACAG------------------------CCACTCACTCCAAGCAAAGATGATGAGAAAAACCCTGGTCTTGTC
TRN  10010101100011001
NAM  Q9S9P3_ARATH/114-228
ASQ  PHNVYVWPWMGIVVN-PLKEADD-KELLLDSAYWL-QT---LSKFKPIEVNAFWV.EQDSIVGVIAKFNGDWSGFAGATELEKEFETQGSSKKEWTERSGDSESKAYGWCARADDFESQGPI
DSQ  CCTCATAACGTCTATGTCTGGCCATGGATGGGGATTGTTGTTAAC---CCTTTGAAAGAAGCGGATGAC---AAGGAACTTCTACTTGATTCAGCATATTGGCTG---CAGACC---------CTTTCCAAATTCAAGCCTATTGAGGTGAATGCCTTTTGGGTC...GAACAAGATTCGATTGTTGGGGTTATTGCTAAGTTTAACGGAGACTGGAGTGGCTTTGCTGGTGCCACAGAGCTTGAAAAAGAATTTGAGACCCAAGGGTCCAGCAAAAAGGAGTGGACTGAGAGGAGCGGAGATTCAGAGTCAAAGGCCTATGGTTGGTGTGCACGTGCAGACGACTTTGAATCTCAAGGTCCAATA
TRN  10010101100011001
NAM  Q9SAI1_ARATH/114-228
ASQ  VDDIYVWPWMGIVIN-PVRRTDN-KNVLLDSAYWL-KK---LARFNPLEVKTLWL.DQESVVAVIPQFNSGWSGFKSVTELEKEYEIRGCGRKDWIDKRGDWRSKAYGWCARADDYNSQGSI
DSQ  GTGGATGACATTTATGTCTGGCCTTGGATGGGGATTGTCATCAAC---CCTGTAAGAAGAACTGATAAC---AAGAATGTGCTCCTTGATTCAGCCTACTGGTTG---AAGAAG---------CTCGCTAGGTTCAATCCTCTTGAGGTGAAAACCCTTTGGCTT...GACCAGGAATCCGTAGTTGCCGTCATTCCTCAGTTTAACAGTGGTTGGAGTGGGTTTAAGAGTGTCACAGAGCTTGAGAAGGAATATGAGATTAGGGGCTGCGGCAGAAAGGACTGGATTGATAAAAGAGGAGACTGGAGGTCTAAGGCTTATGGTTGGTGCGCACGTGCAGATGACTACAACTCTCAAGGGTCGATA
TRN  10010101110011001
NAM  Q9M150_ARATH/28-146
ASQ  QQKRYVWPWVGLVANVPTEVEPSGRR-VGKSGSTLRDEFT-LKGFNPTRVKPIWN.TKGHTGFALVEFAKDFKGFESAMQFEKSFDLDRHGKRDWKKGHRLRDDKLYGWLAREDDYNRSDTV
DSQ  CAACAAAAACGATATGTGTGGCCATGGGTTGGTCTAGTAGCCAACGTACCAACTGAGGTGGAACCATCTGGTCGGAGA---GTAGGCAAAAGCGGTTCAACGTTACGTGATGAGTTCACT---CTGAAAGGGTTTAATCCAACAAGAGTCAAACCCATTTGGAAT...ACCAAGGGACATACTGGTTTTGCTTTGGTTGAATTCGCTAAAGACTTTAAAGGATTCGAAAGCGCCATGCAATTCGAAAAGAGTTTTGATTTAGACCGTCATGGGAAGAGAGATTGGAAAAAAGGTCATCGCTTGAGAGATGATAAGCTTTATGGATGGCTTGCGAGAGAGGATGATTATAATCGAAGTGATACTGTT
TRN  10010101100011000
NAM  Q9SMN2_ARATH/123-240
ASQ  HDEKLVYPWKGIVVNIPTTKAQDGRS-AGESGSKLRDEYI-LRGFNPTRVRPLWN.YLGHSGTAIVEFNKDWNGLHNGLLFDKAYTVDGHGKKDWLKKDGP-KLGLYGWIARADDYNGNNII
DSQ  CATGACGAGAAGCTTGTGTATCCTTGGAAAGGTATTGTGGTGAATATTCCAACTACAAAGGCACAAGATGGTCGATCT---GCGGGCGAGAGTGGATCGAAGCTAAGGGATGAGTATATT---CTAAGAGGATTTAACCCGACTAGAGTTCGTCCTTTATGGAAC...TACTTGGGACATTCAGGAACAGCTATTGTGGAGTTTAACAAAGATTGGAATGGACTTCACAATGGTCTTTTGTTTGACAAGGCTTATACAGTAGATGGTCATGGGAAGAAGGACTGGTTGAAGAAAGACGGTCCC---AAGTTAGGTCTTTACGGTTGGATTGCTCGTGCTGATGATTATAACGGTAATAATATTATT
TRN  10010101110011000
NAM  Q9LHB1_ARATH/116-233
ASQ  QFEKLVWPWKGVLVNIPTTSTEDGRSCTGESGPKLKDELI-RRGFNPIRVRTVWD.RFGHSGTGIVEFNRDWNGLQDALVFKKAYEGDGHGKKDWLCGA--TDSSLYAWLANADDYYRANIL
DSQ  CAGTTCGAGAAACTTGTGTGGCCTTGGAAAGGAGTTTTGGTTAATATTCCCACGACGAGTACAGAAGATGGTCGGTCTTGTACTGGAGAGAGTGGACCAAAACTTAAGGATGAATTAATC---CGAAGAGGATTCAACCCAATTAGAGTTCGTACTGTGTGGGAC...CGTTTCGGTCATTCGGGAACCGGAATAGTGGAATTTAACAGAGACTGGAATGGACTTCAAGATGCTTTGGTGTTTAAGAAGGCTTATGAAGGAGATGGGCATGGGAAAAAGGATTGGCTTTGTGGTGCT------ACTGACTCGAGCCTTTATGCATGGCTTGCCAATGCTGATGATTACTACAGGGCTAACATTTTA
TRN  10010101110011010
NAM  O48878_SORBI/85-199
ASQ  RDEKFVWPWMGILVNVPTE-WKDGRQ-IGESGNRLKEQ---LSHFCPLKVIPLWT.FRGHTGNAIVEFGKDWNGFRNARTFESHFAAGGFGKKDWTGKKNQ-GSELYGWLARAEDYNSPGII
DSQ  AGAGATGAGAAGTTTGTGTGGCCCTGGATGGGCATCCTAGTTAATGTGCCTACTGAA---TGGAAGGATGGGCGCCAA---ATTGGAGAAAGTGGAAATCGTTTGAAGGAGCAA---------CTATCACACTTTTGCCCACTGAAGGTCATCCCGTTATGGACT...TTTAGAGGTCATACAGGAAATGCTATTGTTGAGTTTGGAAAGGACTGGAATGGTTTCAGAAATGCACGTACCTTCGAAAGTCACTTCGCGGCTGGAGGATTTGGTAAGAAGGACTGGACTGGAAAAAAGAACCAA---GGATCCGAGCTCTATGGATGGCTTGCACGAGCTGAAGATTACAATTCTCCAGGAATAATA
TRN  10010101100011000
NAM  Q9SBW2_ORYSA/111-225
ASQ  RDEKFVWPWMGVLVNVPTE-WKDGRQ-IGRSGNHLKEQ---LSRFCPLKIIPLWN.FRGHSGNAIVEFGKDWHGFRNALAFEDYFGKEGYGRRDWKEKQNQ-GSNLFGWVARAEDHTSPGLI
DSQ  AGAGATGAGAAGTTCGTGTGGCCCTGGATGGGTGTTCTAGTTAATGTGCCTACCGAA---TGGAAGGATGGGCGCCAA---ATTGGACGAAGTGGAAATCATTTGAAGGAGCAA---------CTGTCACGCTTTTGCCCACTTAAGATCATTCCATTATGGAAT...TTTAGAGGTCATTCAGGGAATGCTATTGTTGAGTTTGGAAAAGATTGGCATGGCTTCAGAAATGCGCTTGCCTTTGAAGATTACTTTGGGAAAGAAGGATATGGTAGGAGGGACTGGAAGGAGAAACAGAATCAA---GGGTCAAACCTCTTTGGATGGGTTGCAAGAGCTGAAGATCACACTTCTCCAGGGCTAATA
TRN  10010101100011000
NAM  Q9LMH6_ARATH/215-334
ASQ  GDQMYVHPWKGILANMKRTFNEKTRKYAGESGSKIREDLI-KKGFNPHKVTPLWNgRLGFTGFAIVDFGKEWEGFRNATMFDKHFEVSQCGKRDHDLTR-DPGDKLYGWVAKQDDYYSRTAI
DSQ  GGGGATCAGATGTATGTGCATCCCTGGAAAGGTATCCTGGCGAATATGAAAAGAACGTTTAATGAAAAAACAAGGAAGTATGCTGGTGAGAGTGGAAGCAAGATAAGAGAAGATTTGATC---AAGAAAGGGTTTAATCCCCATAAAGTCACGCCACTGTGGAACggaAGACTTGGGTTTACTGGTTTTGCTATTGTTGACTTTGGTAAAGAGTGGGAAGGATTCAGAAACGCGACCATGTTTGATAAACACTTTGAAGTGAGTCAGTGTGGGAAAAGAGACCATGATCTCACACGT---GATCCAGGTGATAAGCTTTATGGTTGGGTAGCAAAACAAGATGACTACTATTCAAGAACTGCTATT
TRN  10010101100011001
//