EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03465 - eRF1_3)
FAM  PF03465
PID  eRF1_3
DES  eRF1 domain 3
IPR  IPR005142
ANO  35
ALN  146
AID  0.312117
APH  (((((((Y174_METJA/254-347:0.25012,((((RF1_AERPE/279-371:0.37897,RF1_SULSO/275-369:0.58215):0.38873,((((((ERF1_PODAN/281-419:0.29719,ERF1_SCHPO/277-417:0.49105):0.12552,(ERF1_TRYBB/281-421:0.58139,ERF1_CAEEL/288-425:0.22538):0.06142):0.10819,(ERF1_TETTH/279-415:0.52111,(ERF1_STYMT/285-423:0.23450,Q9BMX1_EUPAE/276-414:0.40013):0.09713):0.13452):0.06976,(ERF1_BLEAM/280-416:0.43679,O96203_PLAF7/276-412:0.36722):0.04083):0.10171,ERF1_GIALA/290-433:0.68698):0.12080,Q98RP4_GUITH/277-409:0.91746):0.52926):0.27905,((RF1_ARCFU/270-403:0.38933,RF1_THEVO/277-411:0.64288):0.14546,((RF1_METTH/274-407:0.42940,RF1_PYRHO/278-417:0.60197):0.13249,RF1_METJA/277-420:0.65029):0.12535):0.06153):0.08168,((Q97BJ3_THEVO/247-339:0.32130,Q9HJ74_THEAC/247-339:0.23528):0.57387,RF1_HALN1/281-415:0.73305):0.21619):0.35750):0.16828,((Q9YAZ5_AERPE/238-338:0.73361,P96026_SULSO/245-344:0.64178):0.14726,(O27679_METTH/266-360:0.44711,Q9V0V3_PYRAB/260-356:0.34192):0.10330):0.12448):0.05936,(O29421_ARCFU/246-343:0.47253,Q9HPR5_HALN1/254-357:0.52331):0.17546):0.42354,(DOM34_YEAST/202-302:0.27401,P79004_SACPS/277-377:0.37256):0.25064):0.19754,Q9USL5_SCHPO/271-371:0.43126):0.22679,Q9ZT87_ARATH/271-371:0.16902):0.06671,PELO_DROME/271-371:0.27586,(PELO_HUMAN/271-371:0.19901,YNU6_CAEEL/271-371:0.28014):0.03825);
ATP  (((((((Y174_METJA/254-347,((((RF1_AERPE/279-371,RF1_SULSO/275-369),((((((ERF1_PODAN/281-419,ERF1_SCHPO/277-417),(ERF1_TRYBB/281-421,ERF1_CAEEL/288-425)),(ERF1_TETTH/279-415,(ERF1_STYMT/285-423,Q9BMX1_EUPAE/276-414))),(ERF1_BLEAM/280-416,O96203_PLAF7/276-412)),ERF1_GIALA/290-433),Q98RP4_GUITH/277-409)),((RF1_ARCFU/270-403,RF1_THEVO/277-411),((RF1_METTH/274-407,RF1_PYRHO/278-417),RF1_METJA/277-420))),((Q97BJ3_THEVO/247-339,Q9HJ74_THEAC/247-339),RF1_HALN1/281-415))),((Q9YAZ5_AERPE/238-338,P96026_SULSO/245-344),(O27679_METTH/266-360,Q9V0V3_PYRAB/260-356))),(O29421_ARCFU/246-343,Q9HPR5_HALN1/254-357)),(DOM34_YEAST/202-302,P79004_SACPS/277-377)),Q9USL5_SCHPO/271-371),Q9ZT87_ARATH/271-371),PELO_DROME/271-371,(PELO_HUMAN/271-371,YNU6_CAEEL/271-371));
ATL  21.3457
DNO  30
DLN  438
DID  0.436696
DPH  ((((((((Q9V0V3_PYRAB/260-356:0.27149,(((((YNU6_CAEEL/271-371:0.28723,(PELO_HUMAN/271-371:0.24017,(Q9ZT87_ARATH/271-371:0.23551,PELO_DROME/271-371:0.31766):0.10045):0.06863):0.17891,Q9USL5_SCHPO/271-371:0.39001):0.11613,(DOM34_YEAST/202-302:0.29030,P79004_SACPS/277-377:0.29082):0.13635):0.22872,(Y174_METJA/254-347:0.25304,P96026_SULSO/245-344:0.59414):0.08413):0.22259,O27679_METTH/266-360:0.36032):0.06910):0.04642,((Q9YAZ5_AERPE/238-338:0.50628,Q9HPR5_HALN1/254-357:0.27596):0.08673,O29421_ARCFU/246-343:0.27413):0.14177):0.15106,((((ERF1_SCHPO/277-417:0.40628,((ERF1_CAEEL/288-425:0.24177,(ERF1_BLEAM/280-416:0.33853,(O96203_PLAF7/276-412:0.24341,Q98RP4_GUITH/277-409:0.49657):0.12211):0.10671):0.06419,(ERF1_TETTH/279-415:0.41925,Q9BMX1_EUPAE/276-414:0.24841):0.09082):0.09559):0.08449,ERF1_GIALA/290-433:0.55414):0.06653,ERF1_TRYBB/281-421:0.45425):0.12174,ERF1_PODAN/281-419:0.18735):0.34928):0.10210,RF1_ARCFU/270-403:0.29912):0.07552,RF1_METTH/274-407:0.38051):0.06896,RF1_THEVO/277-411:0.49316):0.19490,RF1_PYRHO/278-417:0.28911):0.46563,Q97BJ3_THEVO/247-339:0.32389,Q9HJ74_THEAC/247-339:0.27202);
DTP  ((((((((Q9V0V3_PYRAB/260-356,(((((YNU6_CAEEL/271-371,(PELO_HUMAN/271-371,(Q9ZT87_ARATH/271-371,PELO_DROME/271-371))),Q9USL5_SCHPO/271-371),(DOM34_YEAST/202-302,P79004_SACPS/277-377)),(Y174_METJA/254-347,P96026_SULSO/245-344)),O27679_METTH/266-360)),((Q9YAZ5_AERPE/238-338,Q9HPR5_HALN1/254-357),O29421_ARCFU/246-343)),((((ERF1_SCHPO/277-417,((ERF1_CAEEL/288-425,(ERF1_BLEAM/280-416,(O96203_PLAF7/276-412,Q98RP4_GUITH/277-409))),(ERF1_TETTH/279-415,Q9BMX1_EUPAE/276-414))),ERF1_GIALA/290-433),ERF1_TRYBB/281-421),ERF1_PODAN/281-419)),RF1_ARCFU/270-403),RF1_METTH/274-407),RF1_THEVO/277-411),RF1_PYRHO/278-417),Q97BJ3_THEVO/247-339,Q9HJ74_THEAC/247-339);
DTL  13.8703
RID  0.315815
RPH  ((((((ERF1_TRYBB/281-421:0.59537,((ERF1_SCHPO/277-417:0.48297,ERF1_PODAN/281-419:0.30608):0.11699,ERF1_CAEEL/288-425:0.23514):0.08771):0.01234,(Q9BMX1_EUPAE/276-414:0.40023,ERF1_TETTH/279-415:0.50760):0.16200):0.09427,ERF1_GIALA/290-433:0.79445):0.03271,ERF1_BLEAM/280-416:0.45720):0.05124,O96203_PLAF7/276-412:0.32644):0.13930,(((Y174_METJA/254-347:0.18135,((((O27679_METTH/266-360:0.44296,Q9V0V3_PYRAB/260-356:0.35478):0.08193,(P96026_SULSO/245-344:0.66843,Q9YAZ5_AERPE/238-338:0.72772):0.16373):0.09881,(Q9HPR5_HALN1/254-357:0.56753,O29421_ARCFU/246-343:0.43846):0.17686):0.09949,((Q9USL5_SCHPO/271-371:0.38449,(((PELO_DROME/271-371:0.26586,Q9ZT87_ARATH/271-371:0.20266):0.04676,PELO_HUMAN/271-371:0.20587):0.06926,YNU6_CAEEL/271-371:0.22632):0.25487):0.17756,(P79004_SACPS/277-377:0.39094,DOM34_YEAST/202-302:0.25192):0.31186):0.42687):0.15677):0.38483,((RF1_METTH/274-407:0.52409,RF1_PYRHO/278-417:0.48516):0.23055,(RF1_THEVO/277-411:0.60173,RF1_ARCFU/270-403:0.42674):0.08669):0.23817):0.00000,(Q9HJ74_THEAC/247-339:0.17702,Q97BJ3_THEVO/247-339:0.37700):0.69738):0.71668,Q98RP4_GUITH/277-409:0.87514);
RTP  ((((((ERF1_TRYBB/281-421,((ERF1_SCHPO/277-417,ERF1_PODAN/281-419),ERF1_CAEEL/288-425)),(Q9BMX1_EUPAE/276-414,ERF1_TETTH/279-415)),ERF1_GIALA/290-433),ERF1_BLEAM/280-416),O96203_PLAF7/276-412),(((Y174_METJA/254-347,((((O27679_METTH/266-360,Q9V0V3_PYRAB/260-356),(P96026_SULSO/245-344,Q9YAZ5_AERPE/238-338)),(Q9HPR5_HALN1/254-357,O29421_ARCFU/246-343)),((Q9USL5_SCHPO/271-371,(((PELO_DROME/271-371,Q9ZT87_ARATH/271-371),PELO_HUMAN/271-371),YNU6_CAEEL/271-371)),(P79004_SACPS/277-377,DOM34_YEAST/202-302)))),((RF1_METTH/274-407,RF1_PYRHO/278-417),(RF1_THEVO/277-411,RF1_ARCFU/270-403))),(Q9HJ74_THEAC/247-339,Q97BJ3_THEVO/247-339)),Q98RP4_GUITH/277-409);
RTL  17.9973
LNK  DOM34_YEAST/202-302:P33309:L11277
LNK  ERF1_BLEAM/280-416:Q9BMM3:AF317831
LNK  ERF1_CAEEL/288-425:O16520:AF016452
LNK  ERF1_GIALA/290-433:Q9NCP1:AF198107
LNK  ERF1_PODAN/281-419:O59948:AF053983
LNK  ERF1_SCHPO/277-417:P79063:D63883
LNK  ERF1_STYMT/285-423:Q9BMM1:
LNK  ERF1_TETTH/279-415:Q9U8U5:AB026195
LNK  ERF1_TRYBB/281-421:Q9NAX8:AF278718
LNK  O27679_METTH/266-360:O27679:AE000923
LNK  O29421_ARCFU/246-343:O29421:AE001046
LNK  O96203_PLAF7/276-412:O96203:AE001402
LNK  P79004_SACPS/277-377:P79004:Z86109
LNK  P96026_SULSO/245-344:P96026:U67942
LNK  PELO_DROME/271-371:P48612:U27197
LNK  PELO_HUMAN/271-371:Q9BRX2:AY117399
LNK  Q97BJ3_THEVO/247-339:Q97BJ3:BA000011
LNK  Q98RP4_GUITH/277-409:Q98RP4:AF165818
LNK  Q9BMX1_EUPAE/276-414:Q9BMX1:AF298832
LNK  Q9HJ74_THEAC/247-339:Q9HJ74:AL445066
LNK  Q9HPR5_HALN1/254-357:Q9HPR5:AE005064
LNK  Q9USL5_SCHPO/271-371:Q9USL5:AL109736
LNK  Q9V0V3_PYRAB/260-356:Q9V0V3:AJ248285
LNK  Q9YAZ5_AERPE/238-338:Q9YAZ5:BA000002
LNK  Q9ZT87_ARATH/271-371:Q9ZT87:AF069497
LNK  RF1_AERPE/279-371:Q9YAF1:
LNK  RF1_ARCFU/270-403:O29048:AE001020
LNK  RF1_HALN1/281-415:Q9HNF0:
LNK  RF1_METJA/277-420:Q58239:
LNK  RF1_METTH/274-407:O26964:AE000864
LNK  RF1_PYRHO/278-417:O59264:AP000006
LNK  RF1_SULSO/275-369:Q97W96:
LNK  RF1_THEVO/277-411:P58227:AP000992
LNK  Y174_METJA/254-347:Q57638:U67474
LNK  YNU6_CAEEL/271-371:P50444:Z36238
AMK  xxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx......xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx......xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q98RP4_GUITH/277-409
ASQ  CIKEKKIIESFFDEIEK.DTGKYVYGCEETCNSLTNGFLSKIILWENLEIERMVYIDS---..FTNLEIVKFKKINECDKTECLDEN--..PKLVFSAKCNVIDWVIENKNKCETQIYIITDRTPEGAQFVKGFGGIGGILKF---
DSQ  TGTATAAAAGAAAAAAAAATTATTGAATCTTTTTTTGATGAAATCGAAAAA...GATACGGGAAAATATGTTTATGGATGTGAAGAAACATGTAATTCTTTAACAAACGGATTCTTATCAAAAATAATTTTATGGGAAAATCTGGAAATAGAAAGAATGGTATACATCGATTCG---------......TTTACTAATTTAGAAATAGTTAAATTTAAAAAAATAAATGAGTGTGATAAAACTGAATGTTTAGATGAAAAC------......CCAAAGCTTGTATTTTCAGCCAAATGTAACGTGATTGATTGGGTAATTGAAAATAAAAATAAATGTGAAACACAAATATATATTATAACAGATAGAACTCCAGAAGGTGCTCAATTCGTAAAAGGATTTGGTGGTATTGGCGGAATATTGAAATTT---------
TRN  10010101100011000
NAM  ERF1_GIALA/290-433
ASQ  LIQEVKLLTEFTENIAK.DTKRVCFGITDTIRCLEMSAVEKLIVWDDLPYHRVT-LQCVINgeTSAPVIKYLLKSQMSNPKYLREVINGeeVQLDIMGDQLLLEWFVDNYKNYGASLEFITNRSAEGTQFCSGFGGIGGLLRWQVD
DSQ  CTTATTCAGGAGGTCAAGCTCCTTACGGAATTCACAGAGAACATTGCAAAG...GACACCAAGCGCGTCTGTTTCGGAATAACTGACACCATTCGCTGTCTTGAAATGTCTGCAGTTGAGAAGCTAATTGTTTGGGACGATCTCCCTTATCACCGGGTCACC---CTCCAATGTGTTATCAATggtgaaACCAGTGCCCCCGTGATAAAGTACCTCTTGAAGTCTCAGATGAGCAACCCAAAGTACCTAAGAGAGGTCATCAACGGAgaggagGTGCAGCTAGACATCATGGGCGATCAGTTACTCTTAGAGTGGTTTGTTGACAACTACAAGAATTATGGCGCAAGCTTGGAGTTTATAACAAACAGAAGCGCAGAGGGCACCCAGTTCTGCTCTGGATTTGGTGGAATTGGCGGACTCTTAAGGTGGCAGGTGGAT
TRN  10010101110011010
NAM  ERF1_TRYBB/281-421
ASQ  LVQEKKLLQGFFDQIAC.DTQLYCFGVQDTLKCLEAGAVETLIVYEDLNIYRYTVVKNRGA..DDEETFVHVMSEEEAKRSNIHMQESG..KTRNEIEQEDFVDWLATNYRKFGCALELITNRSQEGTQFVRGFGGIGGVLRYKLD
DSQ  CTCGTACAAGAGAAGAAACTACTTCAGGGATTCTTCGATCAGATCGCTTGT...GATACGCAGCTGTATTGCTTTGGTGTTCAGGATACCCTGAAGTGCTTGGAGGCGGGCGCGGTGGAAACACTTATTGTGTATGAAGACCTTAACATTTACCGCTACACTGTTGTGAAGAATCGCGGAGCA......GACGATGAGGAAACCTTCGTCCATGTTATGTCGGAGGAAGAAGCAAAGAGGTCTAATATACACATGCAGGAGTCCGGG......AAGACACGCAATGAAATTGAACAGGAAGACTTTGTCGACTGGCTCGCGACAAACTACCGCAAGTTTGGTTGCGCCTTGGAGTTGATCACGAATCGCAGCCAGGAGGGAACTCAATTCGTCCGCGGTTTTGGAGGGATTGGAGGTGTGTTGCGGTATAAACTTGAT
TRN  10010101100011011
NAM  ERF1_SCHPO/277-417
ASQ  YVQEKKLIQRFFDEISL.DSGKYCFGVVDTMNALQEGAVETLLCFADLDMIRYE-FKNSEG.nPVITYMTKEQEEKDSTNSFLLDKDTG..AEMELVSSMLLSEWLAEHYKDYGANLEFVSDRSQEGMQFVKGFGGIGAVMRYQLD
DSQ  TATGTCCAAGAGAAAAAATTGATACAACGCTTTTTCGACGAAATTAGCTTA...GATTCGGGTAAATACTGTTTTGGTGTCGTTGATACTATGAATGCCCTTCAGGAAGGTGCCGTAGAAACACTTCTGTGTTTTGCAGACCTTGATATGATCCGTTATGAG---TTTAAGAACTCAGAAGGT...aatCCTGTTATTACATATATGACTAAGGAGCAAGAGGAAAAGGATTCTACCAATTCGTTCTTGCTAGATAAGGATACAGGT......GCTGAAATGGAGTTAGTAAGCTCTATGCTACTCTCTGAATGGCTTGCTGAACATTACAAGGATTACGGTGCTAACTTAGAGTTTGTTTCTGACCGATCTCAGGAAGGTATGCAATTTGTCAAAGGTTTTGGTGGTATTGGTGCTGTTATGCGTTACCAGCTTGAT
TRN  10010101100011000
NAM  Q9BMX1_EUPAE/276-414
ASQ  FVEEKNLISKYFEQIAL.DTGMIVFGVEDTLHSLEIGALDLLMCFENLEINRYE-IRDSA-..NDEIKIYNLNKEQEKDPKYFKNEKTG..ADLEIIKSGPLSEWLCENYSKFGIKLEFITDKSQEGFQFVNGFGGIGGFLRFKLE
DSQ  TTTGTTGAGGAAAAGAACCTCATCAGTAAGTACTTCGAGCAGATTGCACTT...GATACTGGAATGATAGTATTCGGAGTTGAAGATACTCTTCACTCTCTTGAAATTGGAGCTCTCGATTTACTTATGTGATTCGAAAACTTAGAGATTAATAGATATGAA---ATTAGAGACTCTGCT---......AATGATGAAATCAAAATTTACAATCTAAATAAAGAACAAGAAAAAGATCCAAAATACTTCAAAAACGAAAAGACTGGA......GCTGATCTTGAAATCATTAAGAGTGGACCACTTTCCGAATGGCTTTGAGAAAACTACTCAAAGTTCGGAATAAAACTTGAATTTATTACTGACAAATCTCAAGAAGGATTCCAATTTGTCAATGGATTTGGTGGTATTGGAGGATTCCTTAGATTCAAACTCGAG
TRN  00000001000000000
NAM  ERF1_STYMT/285-423
ASQ  FVAEKKLVSKFFEEISL.DTGMIVFGVQDTMKALELGAVETILLFEELEITRYV-IKNPV-..KGDTRTLFLNPTQQKDSKYFKDQASG..LDMDVISEDQLAEWLCHNYQNYXAQVEFITDKSQEGYQFVKGFGGIGGFLRYKVD
NAM  O96203_PLAF7/276-412
ASQ  FIQEKKLIGKFFEEIAQ.DTGKVVYGIDDTLKALEIGAVELLILYEGLDIIRLT-TKNPV-..TNQTKTMHISPCDEKQESLYK--ENN..VELEVVEKISLTDWVIGNYKKYGASLDFVTNKSQEGAQFQKGFGGFGGMLRYKID
DSQ  TTTATTCAAGAGAAAAAATTAATTGGTAAATTTTTTGAAGAAATAGCTCAA...GATACAGGTAAAGTTGTATATGGTATAGATGATACTTTAAAGGCATTAGAAATTGGAGCAGTAGAATTGTTAATTTTATATGAAGGTTTAGATATTATTAGATTAACT---ACAAAAAACCCTGTA---......ACCAATCAAACCAAAACTATGCATATTTCGCCATGTGATGAAAAACAAGAATCATTATATAAA------GAAAATAAT......GTGGAATTAGAAGTAGTAGAAAAAATCTCGTTAACTGATTGGGTTATTGGTAATTATAAAAAATATGGAGCTTCTTTAGATTTTGTAACAAACAAATCACAAGAAGGCGCACAATTTCAAAAAGGTTTTGGAGGTTTTGGTGGAATGTTAAGGTATAAAATTGAT
TRN  10010101110011000
NAM  ERF1_PODAN/281-419
ASQ  FIQEKKLIGKYFEEISQ.DTGRICYGVEDTLKALELGAVETLIVFENLEVTRWV-LKDSN-..GAEIIIHSTKQQDAANRDRFMDKETG..QEMEVVSQESFLEWIAEHYKDFGTTLEFVSDRSTEGNQFVKGFGGIGGILRYKVN
DSQ  TTCATTCAGGAGAAGAAGCTCATCGGCAAGTACTTTGAGGAAATCAGCCAG...GATACCGGCCGTATCTGCTACGGTGTCGAGGATACCCTCAAGGCTTTGGAGCTCGGTGCTGTCGAGACTTTGATTGTCTTTGAGAACCTCGAGGTCACACGCTGGGTC---CTCAAGGACAGCAAT---......GGTGCCGAGATTATCATTCATTCTACTAAGCAGCAGGATGCGGCTAACCGGGACCGGTTCATGGACAAGGAGACTGGC......CAGGAGATGGAAGTTGTCTCCCAGGAGTCTTTCCTCGAGTGGATCGCCGAGCACTACAAGGATTTTGGTACCACTCTGGAGTTCGTTTCGGACAGGTCGACTGAGGGCAACCAGTTCGTCAAGGGCTTTGGCGGTATCGGTGGTATCCTCCGGTACAAGGTCAAC
TRN  10010101100011011
NAM  ERF1_CAEEL/288-425
ASQ  FIQEKKLIGGYFDEISQ.DTGKYVFGVKDTLAALEMGAIETLICWENLDIVRYK-MKNSLG..--EDILLNLRPDEEKDKSHFTDSETG..QDMEIIETMPLLEWFANNYKNFGAALEIVTDKSQEGAQFVRGFGGIGGLLRYRVD
DSQ  TTCATTCAGGAAAAGAAACTGATTGGTGGATATTTCGATGAAATCAGCCAA...GACACTGGAAAATACGTTTTCGGAGTTAAAGACACTCTTGCCGCACTTGAAATGGGAGCTATTGAAACTCTCATCTGCTGGGAGAATTTGGATATTGTTCGGTACAAG---ATGAAAAATTCACTCGGA......------GAGGACATTCTTCTGAATCTGAGACCTGACGAGGAGAAGGACAAATCTCATTTCACCGACAGTGAAACTGGA......CAAGATATGGAAATTATTGAGACTATGCCACTTTTGGAATGGTTTGCTAATAACTACAAGAACTTCGGAGCAGCTTTGGAAATCGTCACAGATAAGTCGCAAGAAGGAGCCCAGTTTGTTCGAGGATTCGGAGGTATCGGAGGATTGCTCCGTTATCGCGTTGAC
TRN  10010101100011001
NAM  ERF1_BLEAM/280-416
ASQ  FIREKKVMSKFFEEVAQ.DTKKYCYGVEDTMKSLLMGAVEVILLFENLNFTRYV-LKNP--..-TTGIEKTLYLTPEQEENHDNFIENG..EELEALEKGPLPEWIVDNYMKFGAGLEFITDRSQEGAQFVRGFGGLGAFLRYQVD
DSQ  TTCATCAGAGAGAAAAAGGTTATGAGCAAGTTCTTCGAAGAAGTCGCACAA...GACACGAAGAAGTACTGCTACGGAGTTGAAGACACAATGAAATCATTGCTTATGGGAGCAGTTGAGGTCATCCTTTTATTCGAAAACCTGAATTTCACAAGGTATGTG---CTGAAAAACCCA------......---ACAACTGGAATTGAAAAGACACTTTACTTAACCCCTGAGCAGGAAGAAAACCATGACAACTTCATTGAAAACGGA......GAAGAATTGGAAGCGTTGGAGAAAGGCCCTCTGCCTGAGTGAATTGTGGACAACTATATGAAGTTTGGGGCTGGTTTAGAATTCATCACTGATAGAAGCCAAGAAGGAGCTCAGTTCGTAAGGGGATTTGGAGGACTTGGAGCATTTTTGAGATACCAAGTTGAC
TRN  00010000000000000
NAM  ERF1_TETTH/279-415
ASQ  FVQEKNVISKFFDCIAI.DSGTVVYGVQDTMQLLLDGVIENILCFEELTTLRVT-RKNKV-..TEQITHIFIPPNELNNPKHFKDGE--..HELEKIEVENLTEWLAEHYSEFGAELYFITDKSAEGCQFVKGFSGIGGFLRYKVD
DSQ  TTCGTTTAAGAAAAGAACGTTATCTCCAAATTCTTCGATTGCATCGCTATT...GACTCCGGTACCGTTGTCTATGGTGTTCAAGATACTATGTAACTCTTATTAGATGGTGTTATTGAAAACATTCTTTGTTTCGAAGAACTCACTACCTTGAGAGTCACT---CGTAAAAATAAAGTC---......ACAGAATAAATCACTCATATATTCATTCCTCCTAATGAATTAAATAATCCTAAGCATTTCAAGGATGGTGAA------......CATGAACTTGAAAAGATTGAAGTTGAAAACTTAACTGAATGGTTAGCTGAACACTACAGTGAATTCGGTGCTGAACTTTACTTTATTACTGATAAATCTGCTGAAGGTTGCCAATTTGTCAAAGGTTTCTCTGGTATTGGTGGTTTCTTAAGATATAAGGTCGAT
TRN  00000100000000000
NAM  RF1_SULSO/275-369
ASQ  YIEVEKLLEELKYHLAK.DDGLIIYGKEQIKKAMEIGAIEAIVIHEDSTDKE---------..--------------------------..-----------LEKLAQDAENYGVKVFVVGDEVPEAEWVKKTFNGIVGKLRYRLY
NAM  RF1_AERPE/279-371
ASQ  YRDAVNAMEEFKLHLAK.GTGMIVYGEKDVEAALEMGAVKTLLIHESRED-----------..--------------------------..-----------LEEWVEKAKSSGAQVIVVPESLAEAEWFLKTFGGLAGILRFRIS
NAM  RF1_METJA/277-420
ASQ  LMKEREAVQRFLKELIKeDGGLACYGEKEVLEALMMGAVDTLIVSEELEKYKVKIACNNCDylEEKTVNKLELIKLEEELKNAQCPKCG..GALSIVEEKDYIEYLSELCEQSGAKLVTVSSETEEGAMILNAFKGIAAILRYKIH
NAM  RF1_THEVO/277-411
ASQ  ISREKDLMDRFLREVKKpDGGLAVYGEKAIRDALEQKMVDLLLISEGIRRVKYT-YKCP--..----TCGEEKTFSEEPSEWPVCDKDG..TPLELIGEDDMIEDLYKLAKESGAQVEIISDQSDEGKLLKQAFGGLAAVLRFIRK
DSQ  ATATCCAGAGAAAAGGATCTCATGGATAGATTCCTAAGAGAAGTCAAAAAAccgGACGGAGGGCTTGCAGTATACGGAGAAAAAGCTATAAGGGATGCACTTGAGCAAAAGATGGTTGATCTGCTTTTGATCTCAGAAGGCATAAGGAGAGTCAAATATACT---TACAAGTGCCCT------......------------ACATGCGGAGAAGAAAAGACGTTTTCTGAGGAACCCTCTGAATGGCCTGTCTGCGACAAAGATGGG......ACGCCTCTTGAGCTTATCGGCGAAGATGACATGATCGAAGATCTGTATAAGTTAGCAAAGGAATCTGGAGCCCAGGTGGAGATTATCTCGGATCAGAGCGATGAGGGGAAACTCTTGAAGCAGGCTTTCGGTGGCCTAGCTGCTGTACTCAGATTCATCAGAAAG
TRN  10010101100011000
NAM  RF1_PYRHO/278-417
ASQ  VIREKKLVNEFLKHVVK.DTGLATYGEREVRRALEIGAVDVLLISEGYNKVR-VRVKCNHC.gWEELKTMSEEEYEVYRKKITKCPKCG..SQNLTIEKWDVAEELIKMAEEAGSDVEIISLDTEEGQQFYRAFGGLGAILRFKI-
DSQ  GTTATTAGAGAGAAAAAACTAGTTAATGAGTTTCTTAAGCATGTAGTAAAG...GATACGGGGCTTGCAACTTACGGTGAGAGGGAAGTTAGGAGGGCATTAGAAATAGGTGCCGTTGACGTTCTATTAATAAGTGAGGGGTACAACAAGGTTAGG---GTTAGGGTTAAGTGCAACCACTGC...ggtTGGGAAGAGCTGAAGACCATGAGCGAGGAAGAATACGAAGTCTATAGGAAGAAAATTACTAAATGCCCCAAGTGTGGA......AGTCAGAACTTAACAATCGAAAAGTGGGATGTTGCAGAGGAGTTAATAAAAATGGCAGAGGAAGCGGGATCGGATGTCGAAATAATATCCCTAGACACTGAAGAAGGTCAGCAGTTCTATAGGGCATTTGGTGGCCTCGGGGCCATACTTAGGTTTAAGATT---
TRN  10010101100011010
NAM  RF1_METTH/274-407
ASQ  VMREKKLVQRFLRELIN.EDGLASYGEREVRQHLQMGAVEVLLLSEDLKYQRGTY------..ECASCGHRMEKTGRDLPDTETCPSCN..DQMRLSDRRDMIDDLVEMAEEVGTEVEIISTETEEGMQLLRAFGGIGAILRYRP-
DSQ  GTTATGAGGGAGAAGAAACTTGTCCAGAGATTCCTCAGGGAACTCATAAAT...GAGGATGGACTCGCATCCTACGGTGAAAGGGAGGTTCGACAGCACCTCCAGATGGGTGCGGTTGAGGTTCTTCTTCTCTCAGAGGACCTTAAGTACCAGAGGGGGACCTAC------------------......GAGTGTGCATCCTGCGGACACAGGATGGAGAAGACGGGCAGGGACCTTCCGGATACTGAAACCTGTCCCAGCTGCAAC......GATCAGATGAGACTCTCAGATAGGAGGGACATGATCGACGACCTCGTTGAGATGGCCGAGGAGGTCGGAACCGAGGTTGAAATCATATCAACTGAGACCGAGGAGGGAATGCAGCTTCTGAGGGCCTTTGGGGGCATAGGGGCGATACTGAGGTACCGCCCC---
TRN  10010101100011001
NAM  RF1_ARCFU/270-403
ASQ  IIREKNLMQRFLKEVAR.D-GLAAYGEEEVRRYIELGAVDTLLLSEDLRYER-VKYR----..CPKCGKEVEVTVREGIEKPPFCEEDN..VEMEEVERRDIVLELSELAESTGAKVEFLSTESEEGEMLYKAFGGIAAILRFKP-
DSQ  ATTATCAGAGAGAAGAACCTGATGCAGAGGTTCCTTAAAGAGGTCGCTAGG...GAT---GGGTTAGCTGCTTACGGTGAGGAGGAGGTAAGGAGGTACATTGAGCTCGGCGCTGTTGACACGCTGCTGCTCTCCGAAGACCTCAGGTACGAGAGG---GTCAAGTACCGA------------......TGCCCCAAGTGCGGCAAGGAGGTTGAGGTGACCGTGAGGGAGGGCATAGAAAAGCCACCCTTCTGCGAGGAGGACAAC......GTCGAGATGGAGGAGGTTGAGAGGAGGGACATCGTGCTTGAGCTCTCAGAGCTTGCGGAAAGCACAGGGGCGAAGGTCGAGTTCCTCTCGACAGAGAGCGAGGAGGGTGAGATGCTTTACAAAGCCTTTGGCGGAATAGCTGCAATTCTCAGATTCAAGCCG---
TRN  10010101100011000
NAM  P96026_SULSO/245-344
ASQ  IAIGAKKMEKAMELLAK.QPELVTYGLEQVKNAIEMGAVETVLVIEDLLSS----------..--------------------------..DEQERLT----IERMLEDIENKRGEVILVPKESPIYFEL-KNLTGILAILRFRIN
DSQ  ATTGCGATTGGAGCTAAGAAAATGGAAAAAGCTATGGAACTCTTGGCTAAG...CAGCCAGAACTAGTAACCTATGGCTTAGAGCAAGTAAAGAATGCTATTGAAATGGGTGCTGTAGAAACTGTTTTAGTGATTGAAGACCTATTATCCTCA------------------------------......------------------------------------------------------------------------------......GATGAACAAGAGAGGCTAACA------------ATCGAAAGAATGCTTGAAGATATAGAAAATAAGAGGGGGGAGGTAATATTAGTACCTAAAGAATCACCAATCTATTTTGAATTA---AAAAATCTTACTGGGATATTAGCTATTCTTAGATTTAGAATAAAT
TRN  10010101110011000
NAM  Q9HPR5_HALN1/254-357
ASQ  IAEESELIDELTTQMAT.D-GKAAYGIDEVQKAVEFGAVEDLLILDERLRLERAGE-----..-------------------------GdwVDVD-------VNDLVRTVEQQGGSVTVFSHEFAPGEQL-RNLGGIGAVLRYRLD
DSQ  ATCGCCGAGGAGTCCGAGCTCATCGACGAGCTTACCACGCAGATGGCGACC...GAC---GGGAAGGCCGCCTACGGCATCGACGAGGTCCAGAAAGCCGTGGAGTTCGGCGCGGTCGAGGACCTGCTGATCCTCGATGAGCGCCTGCGACTGGAGCGCGCCGGCGAG---------------......---------------------------------------------------------------------------GGCgactggGTGGATGTCGAT---------------------GTCAACGACCTCGTCAGGACCGTCGAACAGCAGGGCGGGAGCGTGACCGTGTTCAGCCACGAGTTCGCGCCCGGCGAGCAGCTC---CGGAACCTCGGCGGGATCGGTGCCGTCTTGCGGTATCGGCTCGAC
TRN  10010101100011011
NAM  O29421_ARCFU/246-343
ASQ  LAEEAEYIDRLLEGIAK.G-ERVAYGLDEVREAHNYRAIEVLLVADEFLLEE----REKWD..--------------------------..-----------VDGLLREVEESGGKVVIMSTEFEPGKRL-MSLGGIAALLRFNVK
DSQ  CTTGCTGAGGAGGCGGAGTATATAGACAGGCTGCTTGAAGGGATAGCGAAG...GGA---GAGAGAGTCGCTTACGGTCTGGATGAGGTCAGGGAGGCGCACAATTACAGGGCGATTGAGGTTTTGCTCGTTGCGGATGAGTTTCTGCTTGAGGAG------------AGGGAGAAGTGGGAT......------------------------------------------------------------------------------......---------------------------------GTTGACGGACTGCTCAGGGAAGTTGAGGAGTCGGGCGGAAAGGTGGTGATAATGAGCACCGAATTCGAGCCGGGTAAGAGGCTG---ATGAGCCTCGGTGGAATAGCTGCCCTCCTGAGATTCAACGTAAAA
TRN  10010101100011011
NAM  Q9V0V3_PYRAB/260-356
ASQ  VAQEIKLVEKVIERIAK.D-EPVAYGLKDVEEAVNYGAVDTLLVLDELLKG---DDRE---..--------------------------..----------RIEEIMEMARNLRANVVVVSSEHEGGDKL-KALGGIAAILRFKIH
DSQ  GTTGCCCAGGAGATTAAGTTAGTCGAGAAGGTAATAGAGAGGATAGCCAAG...GAT---GAGCCAGTTGCTTACGGATTAAAGGACGTTGAGGAGGCCGTGAATTACGGTGCCGTCGATACATTGCTAGTCTTGGATGAGCTACTTAAGGGT---------GACGATAGGGAG---------......------------------------------------------------------------------------------......------------------------------AGGATAGAGGAAATCATGGAGATGGCAAGGAATTTAAGGGCGAACGTCGTGGTGGTTAGCTCGGAGCATGAGGGGGGAGATAAGCTT---AAGGCCTTAGGTGGCATCGCCGCAATCTTGAGGTTTAAGATTCAT
TRN  10010101110011010
NAM  Y174_METJA/254-347
ASQ  VAKETQLIEKLLEEIAK.K-GLAVYGIDEVKKALEYSAIDTLLVSDSLVRNH---------..--------------------------..----------EIEKIIDTTEEMGGKVVIVSSEHDAGKQL-KALGGIAGLLRFPIE
DSQ  GTTGCAAAAGAAACACAATTGATAGAAAAGCTTTTGGAAGAGATTGCTAAA...AAG---GGATTGGCTGTTTATGGTATTGATGAAGTAAAAAAAGCTTTAGAATATTCAGCTATAGACACATTATTAGTTTCAGATAGCTTAGTAAGAAATCAT---------------------------......------------------------------------------------------------------------------......------------------------------GAGATAGAAAAAATAATAGATACTACTGAAGAGATGGGTGGGAAGGTAGTTATCGTTTCCTCTGAACATGATGCTGGAAAGCAATTA---AAAGCCTTAGGAGGAATAGCCGGTTTATTAAGATTCCCTATTGAA
TRN  10010101110011000
NAM  O27679_METTH/266-360
ASQ  IASEIRNVNEFLEKLAR.DPDSVVYGKVEVMDAINMGAVEKLLVLDRVVSRED--------..--------------------------..-----------IEGYLDMVESMGGSVVLISSEHEGGKQL-ESLGGLAGILRFKIQ
DSQ  ATAGCCTCTGAGATAAGGAACGTTAACGAGTTCCTTGAGAAGCTGGCCAGG...GACCCTGACTCCGTTGTCTATGGTAAGGTTGAGGTTATGGATGCCATTAACATGGGGGCCGTTGAGAAGCTCCTGGTACTGGACAGGGTTGTTAGCAGGGAGGAC------------------------......------------------------------------------------------------------------------......---------------------------------ATTGAGGGCTACCTCGACATGGTTGAGAGCATGGGCGGTTCCGTGGTACTCATAAGCAGTGAACACGAGGGTGGAAAGCAGCTG---GAATCACTGGGAGGCCTGGCAGGGATTCTAAGATTCAAGATCCAG
TRN  10010101100011001
NAM  Q9USL5_SCHPO/271-371
ASQ  YVQEIRVLNKFYDVMNE.DDRKAWYGPNHVLKAFELGAIGELLISDSLFRSSDIATRKK--..--------------------------..-----------WVSLVEGVKEINCPVYIFSSLHESGKQL-DLLSGIAAILTYPVD
DSQ  TACGTACAAGAAATTCGCGTTCTGAATAAATTTTACGATGTCATGAATGAA...GATGATAGAAAGGCATGGTATGGTCCAAATCATGTTTTGAAGGCTTTTGAACTTGGCGCGATCGGAGAACTTCTGATTAGCGATTCTCTGTTCAGGAGTTCTGACATTGCTACTAGAAAAAAA------......------------------------------------------------------------------------------......---------------------------------TGGGTTTCATTAGTAGAAGGTGTTAAGGAGATTAACTGTCCTGTTTATATTTTCAGTAGTTTGCATGAGTCAGGGAAGCAGCTG---GATCTGTTGTCAGGTATTGCCGCCATTCTCACTTACCCAGTCGAT
TRN  10010101100011000
NAM  YNU6_CAEEL/271-371
ASQ  AQGEVKALNQFLELMST.EPDRAFYGFNHVNRANQELAIETLLVADSLFRAQDIETRRK--..--------------------------..-----------YVRLVESVREQNGKVHIFSSMHVSGEQL-AQLTGCAAILRFPMP
DSQ  GCGCAAGGAGAAGTCAAAGCGTTGAATCAATTTTTGGAATTAATGTCAACA...GAACCTGATCGTGCATTTTATGGCTTCAACCATGTGAATCGTGCAAATCAAGAGCTCGCCATCGAAACACTCCTTGTCGCTGATTCTCTATTCCGAGCCCAAGATATTGAGACACGACGAAAA------......------------------------------------------------------------------------------......---------------------------------TACGTAAGACTTGTGGAAAGTGTTCGAGAACAGAACGGAAAAGTTCACATTTTCTCTTCAATGCACGTTTCTGGAGAACAACTC---GCTCAGTTGACTGGATGTGCAGCTATTTTGAGATTTCCGATGCCT
TRN  10010101110011000
NAM  Q9ZT87_ARATH/271-371
ASQ  AAKEVKALNDFHNMLST.EPDRACYGPKHVEVANERMAIQTLLITDELFRNSDVKTRKK--..--------------------------..-----------YVNLVESVKDSGGDAFIFSAMHVSGEQL-AQLTGIAALLRFPLP
DSQ  GCAGCAAAAGAGGTCAAAGCTCTCAATGATTTTCACAACATGCTTTCAACT...GAACCAGATCGGGCATGCTATGGACCAAAACACGTGGAAGTTGCAAATGAACGAATGGCAATTCAAACGCTTCTCATAACGGACGAGCTTTTCAGGAATTCTGACGTGAAAACAAGGAAGAAG------......------------------------------------------------------------------------------......---------------------------------TATGTGAATTTGGTGGAGTCGGTAAAAGATTCGGGAGGAGATGCTTTTATATTTTCGGCGATGCATGTGTCAGGAGAACAATTG---GCACAGCTGACTGGAATAGCAGCTCTTCTCAGGTTCCCTTTACCA
TRN  10010101100011000
NAM  PELO_HUMAN/271-371
ASQ  AAGEVKALDDFYKMLQH.EPDRAFYGLKQVEKANEAMAIDTLLISDELFRHQDVATRSR--..--------------------------..-----------YVRLVDSVKENAGTVRIFSSLHVSGEQL-SQLTGVAAILRFPVP
DSQ  GCTGCTGGGGAAGTCAAAGCCTTGGATGACTTCTATAAAATGTTACAGCAT...GAACCGGATCGAGCTTTCTATGGACTCAAGCAGGTGGAGAAGGCCAATGAAGCCATGGCAATTGACACATTGCTCATCAGCGATGAGCTCTTCAGGCATCAGGATGTAGCCACACGGAGCCGG------......------------------------------------------------------------------------------......---------------------------------TATGTGAGGCTGGTGGACAGTGTGAAAGAGAATGCAGGCACCGTTAGGATATTCTCTAGTCTTCACGTTTCTGGGGAACAGCTC---AGCCAGTTGACTGGGGTAGCTGCCATTCTCCGCTTCCCTGTTCCC
TRN  10010101100011010
NAM  PELO_DROME/271-371
ASQ  AAGEVKALEQFYMMLQC.EPAKAFYGKKHVLQAAESQAIETLLISDNLFRCQDVSLRKE--..--------------------------..-----------YVNLVESIRDAGGEVKIFSSMHISGEQL-AQLTGIAALLRFPMP
DSQ  GCAGCTGGCGAGGTCAAGGCCCTGGAACAATTCTACATGATGCTGCAATGT...GAGCCCGCCAAGGCCTTCTATGGAAAGAAACATGTCCTCCAAGCCGCCGAGTCGCAGGCCATCGAAACGCTGCTGATCTCGGACAACCTCTTTAGATGCCAAGACGTTAGTCTGAGAAAGGAA------......------------------------------------------------------------------------------......---------------------------------TATGTCAATCTGGTCGAATCCATTCGCGATGCTGGGGGAGAAGTCAAAATCTTTTCGAGCATGCACATCTCAGGAGAACAACTT---GCTCAACTAACTGGAATTGCAGCCCTCCTGCGCTTCCCGATGCCC
TRN  10010101100011001
NAM  P79004_SACPS/277-377
ASQ  LIKEIQIMDDFFEHLNK.DDNKAWYGKEEIKRAAKLEAVETLLITDTVLKSDDIDERET--..--------------------------..-----------FLDLTYNIEQSGGRVFVFSTLQSHGEEL-GRLKGLACILKYPIP
DSQ  CTCATTAAAGAAATTCAAATAATGGATGATTTCTTTGAACATTTAAATAAA...GACGATAACAAAGCGTGGTACGGTAAAGAGGAAATCAAGAGAGCCGCAAAATTAGAAGCAGTAGAAACATTACTTATTACCGATACCGTACTGAAAAGTGACGACATTGATGAGCGTGAGACA------......------------------------------------------------------------------------------......---------------------------------TTCTTGGACTTGACATACAATATTGAACAGAGCGGCGGAAGAGTATTTGTATTCAGTACTCTACAAAGTCATGGTGAAGAACTT---GGGAGGTTAAAAGGGTTGGCTTGTATTTTAAAATATCCAATTCCA
TRN  10010101100011010
NAM  DOM34_YEAST/202-302
ASQ  YSKEIMVMDEFLLHLNK.DDDKAWYGEKEVVKAAEYGAISYLLLTDKVLHSDNIAQRE---..--------------------------..----------EYLKLMDSVESNGGKALVLSTLHSLGEEL-DQLTGIACILKYPLP
DSQ  TACTCCAAAGAAATCATGGTGATGGATGAATTTTTGTTGCATTTAAACAAG...GATGATGATAAAGCTTGGTATGGTGAAAAAGAGGTAGTTAAAGCGGCTGAGTATGGCGCAATTAGTTATTTACTGTTAACAGATAAAGTTTTGCATTCAGACAATATTGCACAAAGAGAG---------......------------------------------------------------------------------------------......------------------------------GAATATTTGAAACTGATGGACTCCGTAGAGAGCAATGGAGGAAAAGCATTGGTATTAAGTACTTTGCATTCTCTTGGAGAAGAACTT---GATCAATTGACGGGTATAGCCTGTATTCTAAAATACCCGCTCCCC
TRN  10010101100011000
NAM  Q9YAZ5_AERPE/238-338
ASQ  IVEAEGVLEEFLRRIAK.SRDTVAYTPGEVLAVARMGAVDTVLLVDTLLHSPDDAVREA--..--------------------------..-----------VDEALRLVESMGGRVIIIPGDSPAGERLV-SFGGVIALLRYPVP
DSQ  ATAGTGGAGGCGGAGGGAGTGCTTGAAGAGTTTCTCAGGAGGATAGCGAAA...TCTAGAGATACGGTGGCCTACACACCCGGCGAGGTCCTCGCCGTCGCCCGGATGGGAGCTGTCGATACAGTGCTCCTCGTAGACACCCTCCTCCACTCCCCGGACGATGCGGTGAGGGAGGCT------......------------------------------------------------------------------------------......---------------------------------GTTGACGAGGCCCTGAGGCTCGTAGAATCTATGGGGGGGAGAGTCATAATAATCCCGGGCGACTCGCCCGCGGGGGAGAGGCTCGTG---AGCTTCGGCGGAGTAATAGCGCTTCTGAGGTACCCGGTCCCG
TRN  10010101100011011
NAM  RF1_HALN1/281-415
ASQ  LMDDKSDMEEFFEELN-.GGKLATYGFEQTRRNLIMGSVDRLLVSEDLREDVVIYE-----..CPNDHEEYETIDRRNTSPEHTCSDCG..EEATEVDREDAIDHLMSIADQRGTETHFISTDFEKGEQLLTAFGGYAGILRYSTG
NAM  Q9HJ74_THEAC/247-339
ASQ  IARDKEIVDEFLVAVKK.D--MGVYGRDQTESALQMGALSDLIITDEMFRT----------..-----------------------EDG..------------RRSLSIAQTVGTRIHIVSVSNDPGQIV-KKFGGFAGILRYRVQ
DSQ  ATCGCCAGGGACAAGGAGATAGTGGATGAGTTTCTGGTCGCAGTGAAAAAA...GAT------ATGGGGGTCTATGGGAGGGACCAGACTGAGAGTGCTCTGCAGATGGGGGCCCTGTCAGACCTCATAATAACCGATGAAATGTTCAGAACA------------------------------......---------------------------------------------------------------------GAGGATGGC......------------------------------------AGAAGATCACTGAGCATTGCTCAAACGGTTGGGACGAGAATACATATAGTGAGCGTGAGCAATGATCCGGGGCAGATAGTG---AAGAAATTCGGTGGATTTGCAGGTATTTTGCGCTACAGGGTGCAG
TRN  10010101100011001
NAM  Q97BJ3_THEVO/247-339
ASQ  ISRDNEIVSAFLSSLRR.G--SGIYGSEEIRKYLEMGALSDLIITDKKFRS----------..-----------------------ETG..------------RELLSLARSVGTDIHIVSTSNDMGEII-EKFGGYAGILRYKVQ
DSQ  ATATCAAGAGACAATGAAATAGTGTCAGCATTCCTTTCTTCGCTTAGGAGG...GGA------AGCGGTATATACGGATCAGAGGAAATAAGGAAGTACCTTGAGATGGGCGCTCTTTCAGATCTGATAATAACAGATAAAAAATTTCGTTCT------------------------------......---------------------------------------------------------------------GAGACTGGC......------------------------------------AGAGAATTGCTATCACTTGCAAGATCCGTTGGTACGGATATACATATTGTAAGCACAAGCAATGATATGGGGGAAATCATA---GAAAAATTTGGAGGATATGCTGGGATACTCAGGTATAAAGTACAA
TRN  10010101100011001
//