EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03433 - EspA)
FAM  PF03433
PID  EspA
DES  EspA-like secreted protein
IPR  IPR005095
ANO  3
ALN  201
AID  0.442223
APH  (Q9R800_ECOLI/3-192:0.01518,O88104_ECOLI/3-190:0.25007,O84945_SALTI/1-193:1.66829);
ATP  (Q9R800_ECOLI/3-192,O88104_ECOLI/3-190,O84945_SALTI/1-193);
ATL  1.93354
DNO  3
DLN  603
DID  0.540826
DPH  (Q9R800_ECOLI/3-192:0.07678,O88104_ECOLI/3-190:0.21524,O84945_SALTI/1-193:1.02223);
DTP  (Q9R800_ECOLI/3-192,O88104_ECOLI/3-190,O84945_SALTI/1-193);
DTL  1.31425
RID  0.442223
RPH  (Q9R800_ECOLI/3-192:0.01518,O88104_ECOLI/3-190:0.25007,O84945_SALTI/1-193:1.66829);
RTP  (Q9R800_ECOLI/3-192,O88104_ECOLI/3-190,O84945_SALTI/1-193);
RTL  1.93354
LNK  O84945_SALTI/1-193:O84945:AE016838
LNK  O88104_ECOLI/3-190:O88104:AJ225017
LNK  Q9R800_ECOLI/3-192:Q9R800:AJ225015
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9R800_ECOLI/3-192
ASQ  TSTGTSVASAN---ASTSTSTVYDLGSMSKDEVVQLFNKVGVFQAALLMFAYMYQAQSDLSIAKFADMNEASKESTTAQKMANLVDAKIADVQSSSDKNKKAKLPQEVIDYLNDPRNDITVSG--ISDLNAELG------AGDLQTVKAAISAKSNNLTTVVNNSQLEIQQMSNTLNLLTSARSDIQSLQYRTISAISLGK
DSQ  ACATCAACTGGCACATCAGTTGCTAGTGCGAAC---------GCGAGTACTTCGACTTCGACAGTCTATGACTTAGGCAGTATGTCGAAAGACGAAGTAGTTCAGCTATTTAATAAAGTCGGTGTTTTTCAGGCTGCGCTTCTCATGTTTGCCTATATGTATCAGGCACAAAGCGATCTGTCGATTGCAAAGTTTGCTGATATGAATGAGGCATCTAAGGAGTCAACCACAGCCCAAAAAATGGCTAATCTTGTGGATGCTAAAATTGCTGATGTTCAGAGTAGTTCTGACAAGAATAAGAAAGCCAAACTTCCTCAAGAAGTGATTGACTATTTAAATGATCCTCGCAATGACATTACAGTAAGTGGT------ATTAGCGATCTAAATGCTGAATTAGGC------------------GCTGGTGATTTGCAAACGGTGAAGGCCGCTATTTCGGCCAAATCGAATAACTTGACCACGGTAGTGAATAATAGCCAGCTTGAAATACAGCAAATGTCAAATACGTTAAACCTATTAACGAGTGCACGTTCTGATATTCAGTCACTGCAATACAGAACTATTTCAGCAATATCCCTTGGTAAA
TRN  10010101100011000
NAM  O88104_ECOLI/3-190
ASQ  NSVTSSISSA-----STSTSMTYDLGNMSKDEVVELFKKVGVFQAALIMFAYMYQAQSELSIATYADMNESSKESTEAQKMANLVDAKIAEVQSSSEKDKKVKLPDEVISYIQDSRNGISVSS--DIDITKELG------AGDLQTVKAAISAKANNLTTTVNNNQLTLQQMSNTLNLLTNARSDMQSLQYRTIQAISFGK
DSQ  AATTCAGTTACATCATCAATTTCTAGTGCG---------------AGTACTTCGACATCGATGACCTATGATTTAGGGAACATGTCGAAAGATGAAGTTGTTGAGCTGTTTAAAAAAGTTGGCGTATTTCAGGCTGCGCTTATCATGTTTGCTTATATGTACCAGGCACAAAGCGAGCTATCTATTGCTACATATGCAGACATGAATGAGTCATCTAAGGAATCCACCGAGGCACAAAAAATGGCCAATTTGGTGGATGCCAAGATCGCTGAAGTTCAGTCTAGTTCGGAAAAGGATAAAAAGGTCAAACTTCCTGACGAAGTAATTAGTTATATTCAAGATTCACGAAATGGGATTTCCGTAAGTAGT------GATATTGACATCACCAAAGAGTTGGGT------------------GCTGGTGACCTGCAAACCGTAAAAGCTGCTATTTCAGCAAAAGCAAATAACCTGACAACGACGGTGAATAATAACCAGCTTACGTTGCAGCAAATGTCTAATACGCTGAATTTATTAACAAATGCTCGTTCAGATATGCAGTCGTTGCAATATCGAACTATTCAGGCAATAAGTTTTGGTAAA
TRN  10010101100011000
NAM  O84945_SALTI/1-193
ASQ  MSSGNILWGSQNPIVFKNSFGVSNADTGSQDDLSQQ-NPFAEGYGVLLILLMVIQA---IANNKFIEVQKNAERARNTQEKSNEMDEVIAKAAKGDAKTKE-EVPEDVIKYMRD--NGILIDGMTIDDYMAKYGDHGKLDKGGLQAIKAALDNDANRNTDLMSQGQITIQKMSQELNAVLTQLTGLIS-KWGEISSMIAQK
DSQ  ATGTCTTCAGGAAACATCTTATGGGGAAGTCAAAACCCTATTGTGTTTAAAAATAGCTTCGGCGTCAGCAACGCTGATACCGGGAGCCAGGATGACTTATCCCAGCAA---AATCCGTTTGCCGAAGGGTATGGTGTTTTGCTTATTCTCCTTATGGTTATTCAGGCT---------ATCGCAAATAATAAATTTATTGAAGTCCAGAAGAACGCTGAACGTGCCAGAAATACCCAGGAAAAGTCAAATGAGATGGATGAGGTGATTGCTAAAGCAGCCAAAGGGGATGCTAAAACCAAAGAG---GAGGTGCCTGAGGATGTAATTAAATACATGCGTGAT------AATGGTATTCTCATCGATGGTATGACCATTGATGATTATATGGCTAAATATGGCGATCATGGGAAGCTGGATAAAGGTGGCCTACAGGCGATCAAAGCGGCTTTGGATAATGACGCCAACCGGAATACCGATCTTATGAGTCAAGGGCAGATAACAATTCAAAAAATGTCTCAGGAGCTTAACGCTGTCCTTACCCAACTGACGGGGCTTATCAGT---AAGTGGGGGGAAATTTCCAGTATGATAGCGCAGAAA
TRN  10010101100011000
//