EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03427 - CBM_19)
FAM  PF03427
PID  CBM_19
DES  Carbohydrate binding domain (family 19)
IPR  IPR005089
ANO  2
ALN  61
AID  0.431034
APH  (CHI1_RHINI/330-390:0.84146,CHI1_RHIOL/338-398:0.20506);
ATP  (CHI1_RHINI/330-390,CHI1_RHIOL/338-398);
ATL  1.04652
DNO  2
DLN  183
DID  0.540984
DPH  (CHI1_RHINI/330-390:0.60356,CHI1_RHIOL/338-398:0.14640);
DTP  (CHI1_RHINI/330-390,CHI1_RHIOL/338-398);
DTL  0.74996
RID  0.431034
RPH  (CHI1_RHINI/330-390:0.84146,CHI1_RHIOL/338-398:0.20506);
RTP  (CHI1_RHINI/330-390,CHI1_RHIOL/338-398);
RTL  1.04652
LNK  CHI1_RHINI/330-390:P29025:D10154
LNK  CHI1_RHIOL/338-398:P29026:D10157
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  CHI1_RHINI/330-390
ASQ  ITTTSLATASSALFPLLYAGRSCSSQSKVSCTSTGSYTICNYGKWVTAPCPPGVICLSSAQ
DSQ  ATCACTACTACATCCTTGGCTACTGCTTCATCTGCCTTGTTCCCTCTTCTATATGCTGGTCGGTCTTGCTCTTCTCAAAGCAAAGTGTCTTGCACATCCACAGGATCCTACACCATCTGCAATTATGGGAAATGGGTCACTGCTCCTTGTCCTCCAGGTGTAATTTGCCTCTCAAGCGCCCAA
TRN  11011101111011001
NAM  CHI1_RHIOL/338-398
ASQ  TTTTAAPTATSAPGSCPVANQSCSTQNQYACTADGKYAVCDHGKWVVSSCPSGTVCIPTTD
DSQ  ACGACGACTACGGCTGCCCCTACTGCTACCAGCGCACCTGGCAGTTGTCCTGTTGCCAATCAATCTTGCTCTACTCAAAACCAATATGCTTGTACAGCCGATGGCAAGTATGCTGTCTGCGACCATGGGAAATGGGTTGTCTCCTCCTGCCCCTCCGGCACTGTCTGCATTCCTACTACCGAT
TRN  11111101111011011
//