EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03379 - CcmB)
FAM  PF03379
PID  CcmB
DES  CcmB protein
IPR  IPR003544
ANO  13
ALN  222
AID  0.399399
APH  (((((Q9Z650_PANCI/2-216:0.24051,CCMB_ECOLI/3-217:0.22588):0.08505,CCMB_HAEIN/3-217:0.18349):0.12456,O52687_SHEPU/11-225:0.16004):0.11741,(((Q9RXA8_DEIRA/4-221:1.65168,((CCMB_PARDE/1-214:0.22387,CCMB_RHOCA/1-215:0.13895):0.06706,O33571_RHOSH/1-215:0.13474):0.22284):0.09510,(Q52735_RHIET/1-216:0.30107,CCMB_BRAJA/4-219:0.26491):0.24021):0.26076,Q9Z3Z2_PSEPU/4-218:0.39163):0.03189):0.47421,CCMB_MARPO/68-273:1.44084,O21279_RECAM/4-220:1.12098);
ATP  (((((Q9Z650_PANCI/2-216,CCMB_ECOLI/3-217),CCMB_HAEIN/3-217),O52687_SHEPU/11-225),(((Q9RXA8_DEIRA/4-221,((CCMB_PARDE/1-214,CCMB_RHOCA/1-215),O33571_RHOSH/1-215)),(Q52735_RHIET/1-216,CCMB_BRAJA/4-219)),Q9Z3Z2_PSEPU/4-218)),CCMB_MARPO/68-273,O21279_RECAM/4-220);
ATL  8.06496
DNO  13
DLN  666
DID  0.472818
DPH  (((CCMB_PARDE/1-214:0.20811,CCMB_RHOCA/1-215:0.14323):0.06387,O33571_RHOSH/1-215:0.18452):0.13051,((Q52735_RHIET/1-216:0.23317,CCMB_BRAJA/4-219:0.20010):0.12020,Q9RXA8_DEIRA/4-221:0.76781):0.04230,((((((CCMB_MARPO/68-273:0.60931,O21279_RECAM/4-220:0.47256):0.41758,CCMB_HAEIN/3-217:0.09272):0.12702,O52687_SHEPU/11-225:0.31580):0.09750,Q9Z650_PANCI/2-216:0.24734):0.14827,CCMB_ECOLI/3-217:0.15430):0.18444,Q9Z3Z2_PSEPU/4-218:0.25939):0.19224);
DTP  (((CCMB_PARDE/1-214,CCMB_RHOCA/1-215),O33571_RHOSH/1-215),((Q52735_RHIET/1-216,CCMB_BRAJA/4-219),Q9RXA8_DEIRA/4-221),((((((CCMB_MARPO/68-273,O21279_RECAM/4-220),CCMB_HAEIN/3-217),O52687_SHEPU/11-225),Q9Z650_PANCI/2-216),CCMB_ECOLI/3-217),Q9Z3Z2_PSEPU/4-218));
DTL  5.41229
RID  0.399399
RPH  (((((Q9Z650_PANCI/2-216:0.24051,CCMB_ECOLI/3-217:0.22588):0.08505,CCMB_HAEIN/3-217:0.18349):0.12456,O52687_SHEPU/11-225:0.16004):0.11741,(((Q9RXA8_DEIRA/4-221:1.65168,((CCMB_PARDE/1-214:0.22387,CCMB_RHOCA/1-215:0.13895):0.06706,O33571_RHOSH/1-215:0.13474):0.22284):0.09510,(Q52735_RHIET/1-216:0.30107,CCMB_BRAJA/4-219:0.26491):0.24021):0.26076,Q9Z3Z2_PSEPU/4-218:0.39163):0.03189):0.47421,CCMB_MARPO/68-273:1.44084,O21279_RECAM/4-220:1.12098);
RTP  (((((Q9Z650_PANCI/2-216,CCMB_ECOLI/3-217),CCMB_HAEIN/3-217),O52687_SHEPU/11-225),(((Q9RXA8_DEIRA/4-221,((CCMB_PARDE/1-214,CCMB_RHOCA/1-215),O33571_RHOSH/1-215)),(Q52735_RHIET/1-216,CCMB_BRAJA/4-219)),Q9Z3Z2_PSEPU/4-218)),CCMB_MARPO/68-273,O21279_RECAM/4-220);
RTL  8.06496
LNK  CCMB_BRAJA/4-219:P30964:M60874
LNK  CCMB_ECOLI/3-217:P33930:U00008
LNK  CCMB_HAEIN/3-217:P45033:U32789
LNK  CCMB_MARPO/68-273:P38454:M68929
LNK  CCMB_PARDE/1-214:P52219:Z71971
LNK  CCMB_RHOCA/1-215:P29960:X63462
LNK  O21279_RECAM/4-220:O21279:AF007261
LNK  O33571_RHOSH/1-215:O33571:U83136
LNK  O52687_SHEPU/11-225:O52687:AF044582
LNK  Q52735_RHIET/1-216:Q52735:U52866
LNK  Q9RXA8_DEIRA/4-221:Q9RXA8:AE001901
LNK  Q9Z3Z2_PSEPU/4-218:Q9Z3Z2:AJ131925
LNK  Q9Z650_PANCI/2-216:Q9Z650:AF103874
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9RXA8_DEIRA/4-221
ASQ  ALSVFLKDLRLEGRSKDVLSTTLFFAGLVVLIMGFAFGPDTAKMRDAAAGVLWCALAFASVLAANRAWAGEQESGALES--LLLYPVAHEWLYLGKAAANALLMLILGVVTAALTAIFFDVHFASLGLLALTLALGVLGLSLVTTFYSAITVNLRAKE--ALLPVLSFPIIIPVMIGAVKSTVLLSGGFNPDDYWAWTRLLLGFDVVTLLVATFAFPHAVES
DSQ  GCACTCAGCGTCTTTCTCAAGGACTTGCGACTGGAAGGCCGCAGCAAGGATGTGCTGTCCACCACGCTGTTTTTCGCCGGACTGGTGGTGCTCATCATGGGCTTCGCCTTCGGCCCCGACACCGCCAAGATGCGCGACGCCGCCGCCGGGGTGCTGTGGTGCGCTCTGGCTTTTGCCAGTGTGCTGGCCGCCAACCGCGCCTGGGCGGGCGAGCAGGAAAGCGGGGCGCTCGAAAGC------CTGCTGCTCTACCCGGTGGCCCACGAGTGGCTCTACCTCGGCAAAGCGGCGGCCAACGCCCTGCTGATGCTCATTCTGGGCGTGGTGACCGCCGCGCTGACCGCCATTTTCTTCGACGTGCACTTCGCCAGCCTGGGGCTGCTCGCGCTGACCCTCGCGCTCGGCGTGCTCGGCCTGAGCCTCGTGACCACCTTCTACTCGGCCATCACCGTCAACCTGCGGGCCAAAGAA------GCCTTGCTACCGGTCCTGAGCTTCCCCATCATCATTCCGGTGATGATTGGGGCGGTCAAAAGTACAGTTCTGCTCAGCGGCGGCTTCAATCCGGACGACTACTGGGCGTGGACGCGGCTGCTGCTCGGTTTCGATGTGGTCACGCTGCTGGTGGCGACCTTCGCTTTTCCGCACGCGGTGGAAAGC
TRN  11011101101011011
NAM  CCMB_HAEIN/3-217
ASQ  FLEIIKRELQIAMRKNAEILNPLWFFLLVITLFPLVIGPDPKLLSRIAPGIAWVAALLSALLSFERLFRDDFIDGSLEQ--LMLTAQPLPMTALAKVVAHWLLTGLPLILLSPIAALLLSLEVNIWWALVLTLLLGTPVLSCIGAIGVALTVGLRKGG--VLLSLLVVPLFIPVLIFASSVLEAAGLN---VPYGGQLAILGAMMVGAVTLSPFAIAAALRI
DSQ  TTTTTAGAGATAATTAAACGAGAACTTCAAATTGCGATGCGTAAAAATGCGGAAATTTTAAATCCGCTATGGTTCTTTTTGCTTGTGATTACTTTGTTTCCGCTTGTTATTGGGCCAGATCCTAAATTACTTTCCCGTATCGCACCGGGTATCGCATGGGTAGCTGCATTACTTTCAGCATTGCTTTCTTTTGAACGTTTATTCCGTGATGATTTTATTGATGGCTCTCTTGAACAA------TTAATGTTAACCGCACAGCCTTTGCCAATGACAGCTTTGGCTAAAGTGGTTGCACATTGGTTGCTCACTGGTTTGCCGCTTATTTTGCTATCACCTATTGCGGCTTTGTTGCTTTCTCTTGAAGTGAATATTTGGTGGGCATTAGTTTTGACATTGTTACTGGGCACCCCTGTATTGAGCTGTATCGGTGCTATTGGCGTGGCTTTAACGGTGGGATTGCGAAAAGGTGGC------GTGTTGTTGAGTTTGCTTGTTGTTCCGTTGTTTATTCCTGTTTTAATTTTTGCTTCATCGGTATTGGAGGCAGCAGGATTAAAT---------GTGCCTTATGGGGGGCAACTGGCGATTTTAGGTGCCATGATGGTTGGCGCTGTAACGCTTTCGCCTTTTGCCATCGCGGCAGCGTTGCGAATT
TRN  10010101100011000
NAM  O52687_SHEPU/11-225
ASQ  FFTLLQRDLKIAIRHRGDIFNPLLFFIMVVTLFPLGIGPEPQMLARIAPGIIWVAALLASMLSLERLFKADFSDGSLEQ--MLLSPQPLAILVLAKVLAHWLLTGVPLILIAPLLAVLLNLEANSYGALIATLALGTPVLSLLGAIGVALTVGLRKGG--VLLSLLILPLYIPVLIFATSAIDAAGMN---LPYDGQLAIIGAMLIGSLTLAPFAIGASLRV
DSQ  TTTTTTACATTACTGCAGCGGGATCTAAAAATCGCGATTCGCCACCGCGGTGATATTTTTAACCCATTGTTATTCTTTATTATGGTTGTCACCCTATTTCCACTTGGTATTGGTCCAGAACCGCAAATGTTGGCGCGTATCGCCCCAGGGATTATTTGGGTTGCGGCATTGCTCGCGTCGATGCTATCGCTTGAGCGCCTTTTTAAAGCCGATTTTAGTGATGGCAGCTTAGAGCAG------ATGCTGCTTAGTCCACAACCGCTCGCCATTTTAGTATTGGCAAAAGTATTAGCTCACTGGTTACTCACGGGTGTCCCACTCATCCTTATCGCACCACTGCTAGCTGTGTTACTGAACTTAGAAGCCAACAGCTATGGAGCCTTGATTGCCACACTGGCTTTAGGCACTCCAGTGTTGTCACTCTTAGGTGCGATTGGCGTAGCATTAACCGTTGGTCTGCGCAAAGGCGGC------GTACTGTTGAGTCTACTCATCCTACCACTTTATATTCCTGTGCTAATTTTCGCGACCAGTGCCATTGATGCAGCAGGAATGAAT---------TTACCCTATGACGGTCAGCTCGCTATAATTGGCGCAATGCTGATCGGTTCGTTAACCTTGGCACCTTTTGCAATAGGTGCATCTCTGCGAGTG
TRN  10010101100011000
NAM  Q9Z650_PANCI/2-216
ASQ  LVSIIRRELKIAFRSGSEIINPLWFFLIVITLFPLGIGPESKLLARIAPGIVWVAALLSSLLALERLFRDDFLDGSLEH--VGVITDPVTFNGTGKVIAHWLVTGVPLIILSPLASLLLSLNFQGWYGLAMTLLLGTPVLSFIGAIGVGLTVGLRRGG--VLLSLLVLPLVIPVLIFSSAAIDAASQG---LSISGYLAILGAMLIASITLAPFATAAAVRI
DSQ  CTGGTAAGTATTATTCGCCGTGAACTTAAAATTGCCTTTCGCAGTGGTTCGGAAATTATTAATCCGCTGTGGTTTTTCCTGATAGTGATTACGTTGTTTCCGCTGGGAATTGGCCCCGAATCAAAATTACTTGCCAGAATTGCACCGGGTATCGTCTGGGTGGCGGCATTGCTGTCATCATTACTGGCACTGGAACGCTTGTTCCGTGATGACTTTCTGGATGGTTCACTGGAACAC------GTTGGTGTTATTACCGACCCCGTTACCTTTAACGGTACTGGAAAAGTCATAGCCCACTGGCTGGTGACCGGGGTACCGTTAATTATTTTGTCGCCCCTGGCCTCGTTATTATTGTCGCTGAATTTTCAGGGCTGGTACGGGCTGGCGATGACACTGCTACTGGGTACACCGGTGTTGAGTTTTATCGGTGCTATCGGGGTAGGGCTGACGGTGGGGCTCAGACGTGGCGGA------GTATTATTGAGTTTACTGGTTTTGCCTCTGGTCATTCCGGTGCTGATTTTTTCAAGTGCAGCCATTGATGCTGCCAGTCAGGGA---------TTATCGATAAGTGGTTACCTGGCCATATTAGGCGCAATGCTAATCGCCAGTATTACTCTGGCACCTTTTGCCACAGCCGCAGCGGTACGTATT
TRN  10010101100011000
NAM  CCMB_ECOLI/3-217
ASQ  FWRIFRLELRVAFRHSAEIANPLWFFLIVITLFPLSIGPEPQLLARIAPGIIWVAALLSSLLALERLFRDDLQDGSLEQ--LMLLPLPLPAVVLAKVMAHWMVTGLPLLILSPLVAMLLGMDVYGWQVMALTLLLGTPTLGFLGAPGVALTVGLKRGG--VLLSILVLPLTIPLLIFATAAMDAASMH---LPVDGYLAILGALLAGTATLSPFATAAALRI
DSQ  TTCTGGCGCATTTTCCGTCTTGAGCTGCGTGTAGCGTTTCGCCATAGCGCCGAAATCGCCAACCCGCTGTGGTTCTTCCTGATTGTAATTACCCTTTTTCCGCTCAGTATCGGTCCGGAGCCGCAACTGCTGGCGCGTATTGCACCGGGCATTATCTGGGTTGCTGCGCTGCTTTCATCCTTGCTGGCGCTGGAACGACTGTTCCGTGACGATTTGCAGGACGGCAGTCTTGAACAA------TTGATGTTGTTGCCGTTACCCTTGCCCGCCGTTGTGCTGGCGAAGGTGATGGCGCACTGGATGGTAACCGGTCTGCCGTTACTCATCCTTTCGCCACTGGTAGCAATGCTACTGGGAATGGATGTTTATGGCTGGCAAGTGATGGCGCTGACGCTGCTGCTGGGAACGCCTACGCTTGGCTTTCTCGGTGCACCGGGCGTGGCGCTGACAGTGGGACTTAAGCGCGGTGGT------GTGCTGCTCAGCATACTGGTGTTACCGCTGACTATCCCATTACTCATCTTTGCCACCGCCGCGATGGACGCGGCTTCTATGCAT---------TTGCCCGTTGACGGGTATCTGGCAATTTTAGGCGCGTTGCTGGCAGGCACCGCGACATTAAGTCCTTTTGCGACGGCGGCAGCGTTACGAATC
TRN  10010111100111000
NAM  Q9Z3Z2_PSEPU/4-218
ASQ  FILLLRREARLLFRRPAELANPLVFFAIVVAMFPLAVGPESQLLQTLSPGLVWVAALLAVLLSLDGLFRSDFEDGSLEQ--WVLSPHPLALLVLAKVLAHWIFSGLPLVLLPPLLALMLGLPSHCLPVLLGSLLLGTPVLSLLGAVGAALTVGLKRGG--LLLALLILPLYIPVLILGSGALQAALQN---MPAAGHLLWLATLTALAVTLAPFAIAAGLKI
DSQ  TTCATCCTGTTGTTGCGTCGCGAAGCGCGCCTGCTGTTCCGTCGCCCTGCCGAGCTGGCCAACCCGCTGGTGTTCTTCGCCATCGTCGTGGCCATGTTCCCGCTGGCGGTCGGCCCGGAAAGCCAATTGTTGCAAACCTTGTCGCCAGGCCTGGTCTGGGTAGCGGCGCTGCTGGCAGTGCTGCTGTCGCTGGACGGCTTGTTCCGCAGCGATTTCGAGGATGGCTCGCTGGAACAG------TGGGTGCTGTCGCCGCACCCGCTGGCGCTGCTGGTGCTGGCCAAGGTGCTGGCGCACTGGATCTTTTCCGGGCTGCCGCTGGTATTGTTGCCGCCGCTACTGGCGCTGATGCTGGGGCTGCCGAGCCATTGCCTGCCGGTGCTGCTCGGCTCCCTGCTGCTGGGCACACCGGTCCTGAGCCTGCTGGGCGCGGTAGGTGCGGCGCTGACAGTCGGTCTGAAGCGCGGTGGT------TTGTTACTGGCGTTGCTGATTCTGCCGTTGTATATCCCTGTATTGATCCTGGGCAGTGGTGCGTTGCAAGCGGCGTTGCAAAAT---------ATGCCCGCAGCCGGCCACCTGCTCTGGCTCGCCACGCTGACGGCCCTGGCCGTTACCCTGGCACCCTTTGCGATAGCGGCCGGCCTGAAGATC
TRN  10010111100111010
NAM  O33571_RHOSH/1-215
ASQ  MIALLLRDLRLALRAGGGFGLGLAFFLLVAVLVPLGVGPEPATLAKIAPGILWVGALLACLLSLDRIFALDHEDGSLDL--LATAPIPLEGVVAVKACAHWIVTGLPLTLVSPLLGLLMNLPAEGYPLLLASLAIGTPALSVIGTFGAALTVGLKRGG--LLLSLLVLPLYVPTLVFGAEAVRRGALG---MDVATPFLLLGGITAGVAALLPFASAAAVRI
DSQ  ATGATCGCGCTTCTCCTCCGGGACCTGCGGCTCGCGCTGCGGGCGGGCGGCGGCTTCGGCCTGGGCCTCGCCTTCTTCCTGCTGGTGGCCGTCCTCGTGCCGCTCGGCGTCGGGCCCGAGCCTGCGACGCTGGCGAAGATCGCGCCCGGCATCCTCTGGGTCGGCGCGCTCCTGGCCTGTCTTCTCTCGCTCGACCGGATCTTCGCGCTCGATCACGAGGACGGATCGCTCGATCTC------CTCGCCACCGCCCCCATCCCGCTCGAGGGGGTGGTGGCGGTGAAGGCCTGCGCGCACTGGATCGTCACCGGCCTGCCGCTGACGCTGGTCTCGCCGCTGCTCGGGCTCCTGATGAACCTGCCGGCCGAGGGCTATCCGCTGCTTCTGGCCTCGCTCGCCATCGGCACGCCGGCGCTCTCGGTGATCGGCACCTTCGGCGCGGCCCTCACCGTCGGGCTGAAGCGGGGCGGG------CTCCTGCTCAGCCTCCTCGTGCTGCCGCTCTATGTGCCGACCCTCGTCTTCGGGGCCGAGGCGGTGCGGCGCGGTGCGCTCGGC---------ATGGATGTCGCGACCCCATTCCTCCTTCTCGGAGGCATCACGGCGGGTGTCGCGGCCCTGCTACCTTTCGCCTCAGCAGCCGCCGTTCGGATA
TRN  10010111100111001
NAM  CCMB_RHOCA/1-215
ASQ  MRALLSRDLRLAIRAGGGFGLGLAFFLIVVTLVPFGVGPQGEILARIASGILWLGALLACLLSLDRIFALDFEDGSLDL--LATAPIPMEAVVTIKALAHWITTGLPLVLAAPLFAVLLHLPAPAYLWLEVSLLLGTPALSVLGTFGAALTVGLKRGG--LLLSLLVLPLYVPTLIFGAELVRRGAEG---LAIEVPLAMLAGITAATVALVPFASAAAIRV
DSQ  ATGAGGGCGCTTTTGTCGCGGGATCTGCGGCTGGCGATCCGGGCCGGGGGCGGCTTCGGGCTCGGGCTTGCATTTTTTCTGATCGTGGTGACGCTGGTGCCCTTTGGCGTCGGCCCGCAGGGCGAGATCCTGGCCCGGATCGCCAGCGGCATCCTGTGGCTGGGCGCCTTGCTCGCCTGTCTTCTGTCGCTCGACCGGATTTTTGCGCTCGATTTCGAGGATGGCTCGCTTGATCTT------CTGGCCACCGCGCCGATCCCGATGGAGGCGGTGGTGACGATCAAGGCGCTGGCGCATTGGATCACCACCGGGTTGCCGCTGGTTCTGGCGGCGCCGCTATTCGCCGTGCTGCTGCATTTGCCCGCGCCCGCCTATCTCTGGCTCGAGGTCTCGCTGCTTCTGGGCACGCCGGCGCTGTCGGTGCTGGGCACCTTTGGCGCGGCGCTGACGGTGGGGCTGAAGCGGGGGGGC------TTGCTGTTGTCGCTGCTGGTGCTGCCGCTTTATGTGCCGACGCTGATCTTTGGCGCCGAACTGGTGCGGCGCGGCGCCGAGGGC---------CTGGCGATCGAAGTGCCGCTGGCGATGCTGGCGGGGATCACCGCGGCCACGGTGGCTTTGGTGCCCTTTGCTTCGGCGGCGGCGATCCGGGTC
TRN  10010101100011011
NAM  CCMB_PARDE/1-214
ASQ  MKALLIRDLRLATRAGGGFGLALAFFLIVCTLVPFGVGPEAGTVSRIA-GILWVGALLSCLLSLDRIFALDFEDGSLDL--LATAPLPLEGAVAIKALADWLVTGLPLALSAPVFGLLLHLPGPRYPWLVASLLLGTPALSVLGSFGAAVTVGLRRGG--LLVSLLVLPLYVPTLIFGAEAVRRGAAG---ADPMTALVFLAAITLATLALAFAAAAASVNL
DSQ  ATGAAGGCGCTGCTGATCCGCGACCTGCGGCTGGCCACGCGCGCGGGCGGGGGCTTCGGCCTTGCGCTGGCGTTTTTCCTGATCGTCTGCACGCTGGTTCCCTTTGGCGTCGGGCCCGAGGCGGGCACCGTCTCGCGCATCGCG---GGCATCCTGTGGGTGGGGGCGCTGCTATCGTGTCTCTTGTCCCTCGACCGCATATTCGCGCTGGATTTCGAGGATGGCAGCCTGGACCTG------CTGGCCACGGCGCCCCTGCCGCTGGAGGGCGCGGTGGCGATCAAGGCGCTGGCCGATTGGCTGGTGACCGGCCTGCCGCTGGCGCTGTCGGCGCCGGTCTTCGGCCTGCTTCTGCACTTGCCGGGACCGCGCTATCCCTGGCTCGTGGCCTCGCTGCTCTTGGGCACGCCCGCGCTGAGCGTGCTGGGCTCCTTTGGCGCCGCGGTGACGGTGGGCCTGCGCCGCGGCGGG------CTGCTCGTGTCGCTGCTGGTGCTGCCGCTTTACGTGCCGACGCTGATCTTCGGGGCCGAGGCGGTGCGACGGGGTGCCGCAGGG---------GCCGATCCGATGACGGCTTTGGTCTTCCTGGCGGCGATCACGCTGGCCACATTGGCGCTGGCCTTCGCCGCAGCCGCAGCCTCCGTCAATCTG
TRN  10010111100111011
NAM  CCMB_BRAJA/4-219
ASQ  LSALIRRDIRIALRVGGGALIGVLFFLTVVVLMPFAVGPDLALLSRLGPAILWLGALLASLLTLDRLFMADHEDGSLDL--ITMSRTPLELACAAKALAHWLAAGLPLIVATPVLGLLLNLDMVATGAVALTLLAGTPALTFTGMIGAALAVTLHRGG--LLMAVLVLPLSIPVLIFGVAASQAVIVG--PMSFGAPFSILCALSLVSLVIGPFAAAASLRH
DSQ  CTGTCCGCCCTCATCCGCCGGGATATCAGGATCGCGCTCCGCGTTGGCGGCGGGGCGCTGATCGGCGTGCTGTTCTTCCTGACCGTGGTGGTGCTGATGCCGTTCGCGGTGGGGCCGGACCTCGCGTTGCTGTCGCGGCTGGGGCCGGCCATTCTCTGGCTCGGCGCCCTGCTGGCGAGCCTGCTGACGCTGGACCGGCTGTTCATGGCCGACCATGAGGACGGCTCGCTCGACCTG------ATCACGATGAGCCGGACGCCGCTGGAACTCGCCTGCGCGGCGAAAGCGCTGGCGCATTGGCTGGCGGCGGGCCTGCCGCTGATTGTCGCAACCCCCGTGCTCGGGCTCTTGCTGAATCTCGACATGGTCGCGACCGGCGCGGTGGCCCTGACGCTGCTCGCGGGCACGCCGGCCCTGACCTTTACCGGCATGATCGGCGCCGCGCTGGCGGTGACGCTGCATCGCGGCGGG------CTTTTGATGGCGGTTCTGGTGCTGCCGCTGTCGATCCCGGTGCTGATCTTCGGGGTCGCGGCCTCCCAGGCCGTGATCGTCGGT------CCCATGTCGTTCGGCGCGCCGTTCTCGATCCTGTGCGCGCTGTCGCTGGTCAGCCTCGTGATCGGCCCCTTCGCCGCGGCGGCGAGCCTGCGGCAT
TRN  10010101100011011
NAM  Q52735_RHIET/1-216
ASQ  MTALFLRDLKLSIRAGGGALIGVLFFLTVVAVIPFGVGPDLKLLSRIGPAIVWIGALLSALLGLDRLFQAERDDGSLDL--MLMQETPLVLTVLVKCFAHWTATGLPLVIASPLLGLFMNMDEAAIGATMLTLLVGSPAITFIGAVGAAVAVALPRGG--LLVSILVLPLTIPVLIFGVSAIYAAVED--PAPFLPPFLILIALTLFFAVIGPAAAALALRN
DSQ  ATGACCGCCCTCTTCCTCCGCGATCTCAAACTCTCGATCCGCGCCGGCGGCGGCGCGCTGATCGGGGTGCTGTTCTTCCTGACAGTCGTCGCCGTCATCCCGTTCGGCGTCGGCCCCGATCTCAAGCTGCTCTCGCGCATCGGCCCCGCCATCGTCTGGATCGGCGCGCTGCTTTCCGCCCTTCTCGGCCTCGACCGCTTGTTCCAGGCCGAGCGCGACGACGGATCCCTCGACCTG------ATGCTGATGCAGGAAACGCCGCTCGTCCTCACCGTGCTGGTCAAATGCTTCGCCCATTGGACCGCCACCGGCCTGCCATTGGTCATCGCCTCGCCGCTGCTCGGCCTCTTCATGAACATGGACGAGGCGGCGATCGGCGCGACCATGCTGACGCTTCTTGTCGGCTCGCCGGCCATCACCTTCATCGGCGCCGTCGGGGCCGCCGTTGCCGTGGCGCTCCCCCGCGGCGGC------CTGCTGGTCTCGATCCTGGTCCTGCCGCTGACCATCCCGGTTCTGATCTTCGGCGTCAGCGCCATCTATGCCGCGGTGGAGGAT------CCCGCACCGTTCCTGCCGCCCTTTCTCATCCTTATCGCGCTCACGCTGTTCTTCGCCGTCATTGGCCCGGCTGCCGCCGCCCTTGCGCTGCGAAAC
TRN  11011101101011011
NAM  O21279_RECAM/4-220
ASQ  FLFQFYYQFSFIIKNKNDYINATLFYLIILIFFPISLKYNQNIIFNTSISIIIIASFLTTIFILNRFFIEDKEEGHLLEYNLLQNKTSLPKLIIIKCFIKWLLISISLILGTFIGIILLNIPFYYYLPIILILLITTLLLILIGSIGSALFIGHKEKS--VLICLFIMPFYLPILIFTTNLLQTILIG---ETINNQFYFISLFFLFLLIFSPNICAYNLKL
DSQ  TTTTTATTTCAATTCTATTACCAATTTTCATTTATTATTAAAAATAAAAATGATTATATAAATGCAACACTTTTTTATCTTATTATTTTAATTTTTTTTCCTATTAGTTTAAAGTATAATCAAAACATTATTTTTAATACATCTATTTCTATTATTATTATAGCATCTTTTTTAACAACTATTTTTATTTTAAATCGATTTTTTATAGAAGATAAAGAAGAAGGTCATTTATTAGAATATAATTTATTACAAAATAAAACATCTTTACCTAAACTAATCATTATTAAATGTTTTATTAAATGGTTATTAATATCAATAAGTCTTATTTTAGGAACATTTATAGGTATTATATTATTAAATATTCCATTTTATTATTATTTACCAATTATATTAATACTTTTAATAACTACATTACTACTAATTTTAATAGGTTCAATAGGATCTGCACTTTTTATTGGACACAAAGAAAAGAGT------GTACTTATTTGTTTATTTATTATGCCTTTTTATTTACCTATTTTAATTTTTACAACAAATCTTTTACAAACAATTCTTATTGGT---------GAAACTATTAATAATCAATTTTATTTTATTAGTCTTTTCTTTCTTTTTTTATTAATTTTTTCTCCCAATATTTGTGCATATAATTTAAAATTA
TRN  10010101110011000
NAM  CCMB_MARPO/68-273
ASQ  FKIFLKLFYQHILLNLSTLITTFSLFLLYIVVTPLMIGFSKDFLCHFHLGLIWICLLFSFLP--ERFFQNDFEDGTLEL--YYLSGYCLQKILLSKLYGHWVLQISGVFCSFPVLQLLYQFDQSKMNW--FTIIIGSQIFTLMCGIHSCLALGITSNGWNSLQNLTTLPTLLPLIVFCTSIETEWFHVIL----------LMGYLLLFLFFYPILVSITLQT
DSQ  TTTAAAATCTTTCTGAAACTGTTTTATCAACATATTTTACTCAATTTATCTACACTAATAACGACTTTTTCTTTATTTTTGTTGTATATCGTAGTCACGCCCTTAATGATAGGCTTTTCTAAAGATTTCTTATGTCATTTCCATTTAGGTTTAATTTGGATTTGTTTGTTGTTTTCCTTTCTTCCT------GAACGTTTTTTTCAAAATGATTTTGAAGATGGTACACTCGAATTG------TATTATTTAAGCGGTTATTGTTTGCAAAAAATCCTACTTTCTAAATTGTATGGTCACTGGGTTCTTCAAATAAGTGGTGTTTTCTGTAGTTTTCCTGTGTTACAACTTCTGTACCAATTTGATCAATCCAAAATGAATTGG------TTCACCATTATTATAGGAAGCCAGATATTTACTCTTATGTGTGGTATTCATTCTTGTTTGGCTCTTGGAATCACATCCAATGGTTGGAACAGCTTGCAAAATCTAACAACCTTACCCACTTTATTGCCCTTAATCGTTTTTTGTACCTCTATTGAAACAGAATGGTTTCATGTTATTTTA------------------------------TTAATGGGATATTTACTTTTGTTTTTATTTTTTTATCCTATTTTGGTCTCAATTACTTTACAAACT
TRN  10010101100011000
//