EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03350 - UPF0114)
FAM  PF03350
PID  UPF0114
DES  Uncharacterized protein family, UPF0114
IPR  IPR005134
ANO  5
ALN  175
AID  0.456946
APH  ((YREP_BUCTS/1-164:0.17324,YREP_BUCTC/1-162:0.26696):0.21763,YQHA_ECOLI/1-164:0.15865,(Y507_HAEIN/16-180:0.75444,Y189_HELPY/2-174:0.63853):0.36182);
ATP  ((YREP_BUCTS/1-164,YREP_BUCTC/1-162),YQHA_ECOLI/1-164,(Y507_HAEIN/16-180,Y189_HELPY/2-174));
ATL  2.57127
DNO  5
DLN  525
DID  0.540115
DPH  (((YREP_BUCTC/1-162:0.20246,YREP_BUCTS/1-164:0.14521):0.24838,YQHA_ECOLI/1-164:0.20538):0.18775,Y507_HAEIN/16-180:0.50341,Y189_HELPY/2-174:0.42801);
DTP  (((YREP_BUCTC/1-162,YREP_BUCTS/1-164),YQHA_ECOLI/1-164),Y507_HAEIN/16-180,Y189_HELPY/2-174);
DTL  1.9206
RID  0.456946
RPH  ((YREP_BUCTS/1-164:0.17324,YREP_BUCTC/1-162:0.26696):0.21763,YQHA_ECOLI/1-164:0.15865,(Y507_HAEIN/16-180:0.75444,Y189_HELPY/2-174:0.63853):0.36182);
RTP  ((YREP_BUCTS/1-164,YREP_BUCTC/1-162),YQHA_ECOLI/1-164,(Y507_HAEIN/16-180,Y189_HELPY/2-174));
RTL  2.57127
LNK  Y189_HELPY/2-174:O24989:AE000539
LNK  Y507_HAEIN/16-180:P44010:U32732
LNK  YQHA_ECOLI/1-164:P67244:U28377
LNK  YREP_BUCTC/1-162:O31285:Y11974
LNK  YREP_BUCTS/1-164:O31289:Y11966
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Y189_HELPY/2-174
ASQ  LEKLIERVLFATRWLLAPLCIAMSLVLVVLGYVFMKELWHMLSHLNTISETDLVLSALGLVDLLFMAGLVLMVLLASYESFVSKLDKVDASE-ITWLKHTDFNALKLKVSLSIVAISAIFLLKRYMSLEDVLSSIPKDTPLSHNPIFWQVVIHLVFVCSALLAAVTNNIAFS-QN
DSQ  TTGGAAAAATTGATTGAAAGAGTGTTGTTTGCCACTCGTTGGTTGCTAGCCCCTTTATGCATTGCCATGTCGTTAGTGCTGGTGGTTTTAGGCTATGTGTTCATGAAAGAGTTGTGGCACATGCTAAGCCATTTAAACACGATCAGCGAAACGGATTTGGTTTTATCAGCCTTAGGCTTAGTGGATTTGTTGTTTATGGCTGGGCTTGTTTTAATGGTGTTGCTCGCTAGTTATGAAAGCTTTGTTTCCAAATTAGACAAGGTGGATGCCAGTGAA---ATCACTTGGCTAAAGCACACGGATTTTAACGCTTTAAAATTAAAGGTTTCACTCTCCATTGTAGCCATTTCGGCGATTTTCTTGCTCAAACGCTACATGAGTTTAGAAGACGTTTTATCCAGCATTCCTAAAGATACGCCCTTATCGCATAACCCCATTTTTTGGCAAGTGGTGATCCATTTGGTGTTTGTGTGTTCAGCGCTTTTAGCCGCCGTTACCAATAACATCGCTTTTTCG---CAAAAT
TRN  10010101100011000
NAM  YREP_BUCTC/1-162
ASQ  MKNIIEKMIYISRWLIFPIYLGLSFCLILLTLKFFQLVFFIFPEIFFISESGLILVILSLIDIVLVGGLLVMVMFSGYENFISKMN-IEGDK-LGWMGTMDVNSIKNKVSSAIVAISSVHLLRVFMETEKVSN----------EKIVWYVIIHLTFVVSAGGMAYIDRLNKS-NI
DSQ  ATGAAAAATATAATTGAAAAAATGATTTATATTTCTCGTTGGTTAATATTTCCAATATATTTAGGATTATCTTTTTGTTTAATTTTGTTAACTTTAAAGTTTTTTCAGTTAGTTTTTTTTATTTTTCCTGAAATTTTTTTTATATCTGAATCAGGTTTAATTTTAGTTATTTTATCTTTAATTGATATTGTTTTAGTAGGTGGTTTATTGGTTATGGTTATGTTTTCTGGTTATGAAAATTTTATTAGTAAAATGAAT---ATTGAAGGAGACAAA---TTAGGTTGGATGGGGACTATGGATGTAAATTCAATAAAAAATAAAGTTTCTTCAGCAATTGTTGCAATATCATCAGTACATTTATTAAGAGTTTTTATGGAAACTGAAAAAGTTTCAAAT------------------------------GAAAAAATAGTTTGGTATGTAATAATTCATTTAACATTTGTAGTTTCAGCTGGAGGTATGGCTTATATTGATAGATTAAATAAATCT---AATATA
TRN  10010101110011000
NAM  YREP_BUCTS/1-164
ASQ  MEKRIANIIYSSRWLMFPVYIGLAFGFVLLTVKFFQQIICVIPEILTMSESGLVLIVLSLIDIALVGGLLVMVMFSGYENFIAKMETTENKKRLSWMGTMDVNSIKNKVASSIVAISSVHLLRLFMDADKISD----------NKIMWCVVIHLTFVLSAFGMAYIDKMSKK-HY
DSQ  ATGGAAAAAAGAATTGCTAATATTATCTATAGTTCACGATGGTTAATGTTTCCTGTTTATATTGGTTTAGCTTTTGGTTTTGTTTTATTAACAGTAAAGTTTTTTCAACAAATTATTTGTGTTATACCTGAGATTTTAACTATGTCCGAATCTGGATTAGTGTTAATTGTATTGTCACTAATAGATATTGCATTAGTAGGAGGATTGTTAGTGATGGTAATGTTTTCTGGTTATGAAAACTTTATAGCAAAAATGGAAACAACAGAAAATAAAAAACGGTTAAGTTGGATGGGTACAATGGATGTGAATTCAATAAAAAATAAAGTTGCTTCTTCTATTGTAGCAATATCTTCAGTGCATTTATTAAGATTATTCATGGATGCAGATAAAATTTCAGAT------------------------------AATAAAATTATGTGGTGTGTAGTTATTCATTTAACTTTTGTTTTATCTGCTTTTGGTATGGCATATATAGATAAAATGAGTAAAAAA---CACTAT
TRN  10010101110011000
NAM  YQHA_ECOLI/1-164
ASQ  MERFLENAMYASRWLLAPVYFGLSLALVALALKFFQEIIHVLPNIFSMAESDLILVLLSLVDMTLVGGLLVMVMFSGYENFVSQLDISENKEKLNWLGKMDATSLKNKVAASIVAISSIHLLRVFMDAKNVPD----------NKLMWYVIIHLTFVLSAFVMGYLDRLTRH-NH
DSQ  ATGGAACGTTTTCTTGAAAATGCAATGTATGCTTCTCGCTGGCTGCTTGCCCCCGTGTACTTTGGCCTTTCGCTGGCGTTAGTTGCCCTGGCGCTGAAGTTCTTCCAGGAGATTATTCACGTACTGCCGAATATCTTCTCGATGGCGGAATCAGATTTGATCCTCGTGTTGCTGTCGCTGGTGGATATGACGCTGGTTGGCGGTTTGCTGGTGATGGTGATGTTTTCCGGTTATGAGAATTTCGTCTCACAGCTGGATATCTCCGAGAACAAAGAGAAGCTGAACTGGCTGGGGAAAATGGACGCAACGTCGCTGAAAAACAAAGTAGCAGCGTCGATTGTGGCAATTTCTTCCATTCACTTACTGCGCGTCTTTATGGATGCGAAAAATGTCCCGGAT------------------------------AACAAACTGATGTGGTACGTCATTATCCATCTGACGTTTGTGCTTTCTGCATTTGTGATGGGCTATCTTGACCGACTGACTCGTCAT---AATCAC
TRN  11011101101011000
NAM  Y507_HAEIN/16-180
ASQ  QSNIIAKIIFASRWLQVPIYLGLIVTLAIYSYKFIKGLWELVINVNDMDSNTIMLGVLNLIDVVMIANLLVMVTIGGYEIFVSKLRTRNHPDQPEWMSHVNATVLKVKLSMSIIGISSIHMLQTFVNASNMPE----------KTMMWQLLLHLGFLVSAIALAYTDKILYSTSH
DSQ  CAATCGAATATTATCGCGAAAATAATTTTTGCTAGTCGCTGGTTGCAAGTGCCGATTTATTTGGGCTTGATTGTCACCCTTGCAATCTACTCTTATAAATTTATCAAAGGATTATGGGAGTTAGTGATTAATGTAAATGATATGGATTCCAACACAATTATGTTAGGCGTGTTGAATTTGATTGATGTCGTGATGATCGCAAACTTGCTTGTGATGGTGACTATCGGTGGCTATGAAATCTTTGTATCTAAATTGCGTACGCGTAATCATCCTGATCAACCTGAATGGATGAGCCACGTAAATGCCACCGTGTTGAAAGTTAAACTTTCTATGTCTATTATCGGCATTTCATCTATCCATATGTTGCAAACTTTTGTGAATGCAAGCAATATGCCAGAA------------------------------AAAACGATGATGTGGCAGTTATTGTTGCATTTGGGCTTTTTAGTGTCGGCAATTGCTTTAGCTTATACGGACAAAATTTTGTATAGCACAAGCCAT
TRN  10010101110011000
//