EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03296 - Pox_polyA_pol)
FAM  PF03296
PID  Pox_polyA_pol
DES  Poxvirus poly(A) polymerase catalytic subunit
IPR  IPR004976
ANO  3
ALN  481
AID  0.609746
APH  (Q9Q944_9POXV/1-470:0.22726,PAP1_VACCC/1-479:0.22165,Q98199_MCV1/1-470:0.49771);
ATP  (Q9Q944_9POXV/1-470,PAP1_VACCC/1-479,Q98199_MCV1/1-470);
ATL  0.94662
DNO  3
DLN  1443
DID  0.561359
DPH  (Q9Q944_9POXV/1-470:0.18217,PAP1_VACCC/1-479:0.34517,Q98199_MCV1/1-470:0.53673);
DTP  (Q9Q944_9POXV/1-470,PAP1_VACCC/1-479,Q98199_MCV1/1-470);
DTL  1.06407
RID  0.609746
RPH  (Q9Q944_9POXV/1-470:0.22726,PAP1_VACCC/1-479:0.22165,Q98199_MCV1/1-470:0.49771);
RTP  (Q9Q944_9POXV/1-470,PAP1_VACCC/1-479,Q98199_MCV1/1-470);
RTL  0.94662
LNK  PAP1_VACCC/1-479:P21079:M35027
LNK  Q98199_MCV1/1-470:Q98199:U60315
LNK  Q9Q944_9POXV/1-470:Q9Q944:AF170722
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9Q944_9POXV/1-470
ASQ  MNAR---------IADLLYNYLGRPPSLSEYHMLKLQHRNIQKIIAFNKDIFISLIKKNKKKFFSDIDLTSSEIKTSVLSYFSKQRDTYSIGKLYTIIELQTILVSTYTDVLGVLTLKGPDMFPSSTRYDIKSIKQIATSALHAMNVAVIS-DKVMGRHNVSPLVSNVNALMEEYLRRHNKNCICYGSYSLYLLNPEVKYGDIDILQTNSRTFLIDLAFLIKFITGSNVVLLKVPYLKNYMVLKDKDDNHIIDSFNIRQETMQVIPKVLIDNIYIVDPALQLMSMFKMFSQIDRLEDLARNPEKLTVRLATLMEYVRVKYGIILNGESNHMPMKGVLDKDKRIIDVDTSGYNFSFKKCYVYLDESSLSSDILDLNADDA-VDFENVSNSAYLINGDVLYTYFSNTILLSDPDTIHEISNKAMSAHILIYQILTGNDIRQPLSDLVNSLMYNEKVLIHEVIPRDKKTGKHGIVDIEKDIITH
DSQ  ATGAATGCACGT---------------------------ATCGCCGATTTGTTGTACAATTACTTGGGTAGACCCCCGTCGTTATCCGAATATCATATGTTGAAATTACAACACAGGAACATACAAAAAATAATAGCGTTTAACAAAGACATATTTATATCGTTGATCAAAAAGAATAAGAAAAAATTTTTCTCTGATATCGATTTGACGTCTTCCGAAATAAAAACATCTGTGTTGTCGTATTTCTCGAAGCAACGAGACACGTATTCTATAGGCAAGTTGTACACTATCATAGAACTACAAACAATTCTCGTATCCACATATACGGACGTCTTAGGAGTCTTGACGCTCAAAGGACCAGATATGTTCCCGTCTAGTACACGGTACGATATAAAGTCGATTAAACAAATTGCGACATCCGCGTTACACGCCATGAACGTGGCCGTTATAAGT---GACAAAGTTATGGGTAGACACAACGTGTCTCCTTTGGTAAGCAACGTGAATGCATTGATGGAGGAATATCTACGCCGACATAACAAAAATTGCATCTGTTACGGGTCGTATTCGCTATATCTCCTTAACCCCGAAGTGAAATATGGAGATATCGACATATTACAGACTAATTCTAGAACGTTTCTGATCGATCTCGCGTTTCTAATTAAGTTCATTACGGGGTCCAATGTCGTCTTGTTAAAGGTACCATACTTGAAGAATTACATGGTCCTGAAGGATAAAGACGACAATCACATCATCGATAGTTTTAACATCCGACAGGAGACGATGCAGGTAATACCCAAAGTACTAATCGATAACATTTACATAGTCGACCCCGCGCTACAACTCATGTCCATGTTTAAGATGTTCTCTCAGATAGATAGATTGGAAGATCTAGCGAGGAACCCGGAAAAATTGACAGTTCGTTTAGCCACTCTAATGGAATACGTACGCGTTAAGTATGGTATCATACTTAACGGGGAATCCAATCATATGCCCATGAAAGGCGTCTTAGATAAAGACAAACGCATCATCGACGTGGATACGAGCGGATACAATTTCTCGTTCAAAAAGTGTTATGTATATTTGGACGAATCGTCACTGTCTAGTGACATACTGGATCTAAACGCGGACGATGCG---GTGGATTTTGAAAACGTGTCAAACTCGGCGTACCTGATAAACGGTGACGTGTTGTACACCTATTTTTCAAACACCATTTTGTTAAGCGATCCCGATACCATTCACGAGATTAGTAATAAAGCAATGAGTGCTCATATTCTGATTTATCAAATTCTTACTGGAAACGATATACGCCAGCCTCTATCTGACCTAGTTAATTCGTTAATGTATAATGAAAAAGTATTAATTCATGAAGTTATACCTCGAGATAAGAAAACCGGTAAACACGGTATCGTTGATATAGAGAAAGATATCATAACACAT
TRN  10010101100011000
NAM  PAP1_VACCC/1-479
ASQ  MNRNPDQNTFPNITLKIIETYLGRVPSVNEYHMLKLQARNIQKITVFNKDIFVSLVKKNKKRFFSDVDTSASEIKDRILSYFSKQTQTYNIGKLFTIIELQSVLVTTYTDILGVLTIKAPNVISSKISYNVTSMEELARDMLNSMNVAIIDKAKVMGRHNVSSLVKNVNKLMEEYLRRHNKSCICYGSYSLYLINPNIRYGDIDILQTNSRTFLIDLAFLIKFITGNNIILSKIPYLRNYMVIKDENDNHIIDSFNIRQDTMNVVPKIFIDNIYIVDPTFQLLNMIKMFSQIDRLEDLSKDPEKFNARMATMLEYVRYTHGIVFDGKRNNMPMKCIIDENNRIVTVTTKDY-FSFKKCLVYLDENVLSSDILDLNADTS-CDFESVTNSVYLIHDNIMYTYFSNTILLSDKGKVHEISARGLCAHILLYQMLTSGEYKQCLSDLLNSMMNRDKIPIYSHTERDKKPGRHGFINIEKDIIVF
DSQ  ATGAATAGGAATCCTGATCAGAATACTTTTCCTAATATTACATTAAAGATTATAGAAACCTATTTAGGCAGAGTACCTAGTGTGAATGAATATCATATGTTAAAATTACAAGCTAGAAATATTCAAAAAATAACTGTTTTTAACAAAGACATATTTGTATCTTTAGTAAAAAAGAATAAAAAAAGATTTTTTTCCGATGTTGATACATCTGCATCAGAAATAAAAGATCGTATACTTAGCTACTTTTCTAAACAGACTCAAACATATAATATAGGTAAATTATTTACGATTATAGAACTACAATCTGTATTAGTGACCACATACACGGACATATTAGGAGTTCTTACTATTAAAGCTCCAAATGTAATTTCATCTAAAATTTCTTATAATGTAACATCAATGGAAGAATTGGCAAGAGATATGCTAAATTCTATGAACGTCGCAATAATAGACAAGGCAAAAGTAATGGGACGTCATAATGTATCTTCCCTAGTCAAAAATGTTAATAAGTTGATGGAAGAATATCTTAGACGCCATAATAAAAGTTGTATATGTTACGGATCATATTCTCTATATCTAATTAATCCAAATATACGGTACGGCGATATAGATATTCTTCAAACTAATTCGAGGACTTTTCTTATAGATTTGGCATTTCTAATAAAATTTATTACGGGAAATAATATTATATTAAGTAAAATCCCATATCTTAGAAACTATATGGTGATAAAAGATGAAAACGATAATCATATCATTGATAGTTTTAATATTCGCCAGGATACCATGAACGTAGTTCCTAAAATCTTTATAGATAATATCTATATAGTGGATCCGACGTTTCAACTATTGAACATGATAAAAATGTTTTCTCAAATAGATAGATTGGAAGATCTATCCAAAGATCCTGAAAAGTTTAATGCACGTATGGCAACTATGCTAGAATACGTTAGATATACACATGGTATAGTCTTTGATGGTAAGCGTAATAATATGCCGATGAAATGTATCATCGATGAAAATAATCGCATAGTTACTGTCACTACTAAAGACTAT---TTTAGCTTTAAAAAATGTCTAGTGTATCTAGATGAAAATGTGTTATCGAGTGATATATTAGATCTTAACGCCGACACATCG---TGTGATTTCGAGAGTGTTACAAATTCTGTATATCTAATTCATGATAATATCATGTATACATATTTCTCAAATACTATTCTCCTTAGTGATAAGGGGAAGGTACATGAAATAAGTGCCAGAGGTTTATGTGCACATATATTGTTGTATCAGATGCTGACATCTGGAGAATACAAACAATGTTTATCGGATCTCTTAAATTCGATGATGAATAGAGATAAAATACCTATCTATTCACATACTGAAAGAGATAAAAAACCTGGACGACACGGATTTATTAATATCGAAAAAGATATAATTGTATTT
TRN  10010101100011000
NAM  Q98199_MCV1/1-470
ASQ  MNGA---------QFELLREYLGRPPTLNQYFIFKPQARAIQRIMRFDTDVFFALIKKNKKRFFARIGGSASEINARVLSYFVKQRATTKVGRILSIIELQSVLVNSYTEIMGVLTLPAPPVYNSVVRLHYCSMERLAEEVLWSYNVAFRS-GKVMGRHCVSNLVVHVNKLMSEYLRRHNRTAICYGSYSLHLLNSRIEYGDIDILQTNARLFLINLAFLIYFITGRNVLLLKVPYLKSYIVMQDEEGRHIIDSFNIRQGTMQNVPKVLVDNIYIIDPVVQLMNTLKMLSQIDRLEDLGERMAKMRLRLATLLEYARYHHCVSFGG-GARLRLHMRLDAGARIVLVDTRCYGLGYRECRCYLDEARLLQDISKLNADAAVVDFEAVSNSVFLIHQGIMYTYFSNTVLLRSEDAIHDVSERAVCAHITLYHLLVGCNYQELLADLLNSLVSREKCPVVGVVARDKKVGRHGVIDIEKDVITH
DSQ  ATGAACGGCGCG---------------------------CAGTTCGAGCTGCTGCGCGAGTACCTGGGCAGGCCGCCCACGCTCAACCAGTACTTCATCTTCAAGCCGCAGGCGCGCGCCATCCAGCGCATCATGCGCTTCGATACCGACGTTTTCTTTGCGCTCATCAAGAAGAACAAGAAGCGCTTCTTTGCGCGCATCGGCGGCAGCGCCAGCGAGATCAACGCGCGCGTGCTGTCCTACTTCGTCAAGCAGCGCGCCACCACCAAGGTGGGGCGCATCCTCTCCATCATCGAGCTGCAGAGCGTGCTGGTCAACAGCTACACCGAGATCATGGGCGTGCTCACGCTGCCCGCGCCGCCCGTGTACAACTCGGTGGTGCGCCTGCACTACTGCTCCATGGAGCGCCTTGCCGAGGAGGTGCTCTGGTCCTACAACGTGGCCTTCCGCAGC---GGCAAGGTCATGGGCCGCCACTGCGTGTCCAACCTGGTGGTGCACGTGAACAAGCTCATGAGCGAGTACCTGCGCCGCCACAACCGCACGGCCATCTGCTACGGCTCCTACTCGCTGCACCTTCTCAACAGCCGCATCGAGTACGGCGACATCGACATCCTGCAGACCAACGCGCGCCTGTTTCTGATCAACCTGGCTTTCCTCATCTACTTCATCACCGGCAGGAACGTGCTCCTGCTCAAGGTACCCTACCTCAAGAGCTACATCGTCATGCAGGACGAAGAGGGCCGCCACATCATCGACAGTTTCAACATCCGCCAGGGCACCATGCAAAACGTGCCCAAGGTGCTGGTGGACAACATCTACATCATCGACCCCGTGGTGCAGCTCATGAATACGCTCAAGATGCTCTCGCAAATCGACCGCCTGGAGGACCTGGGCGAGCGCATGGCCAAGATGCGCCTGCGCCTGGCCACGCTACTCGAATACGCGCGCTACCACCACTGCGTGTCCTTCGGCGGC---GGCGCGCGCTTGCGCCTGCACATGCGGCTGGACGCGGGCGCGCGCATCGTGCTGGTGGACACGCGCTGCTACGGGCTGGGCTACCGCGAGTGCCGCTGCTACCTGGACGAGGCGCGCCTCCTGCAGGACATCTCCAAGCTCAACGCCGACGCCGCCGTGGTCGACTTCGAGGCCGTCTCCAACTCCGTCTTCTTAATTCACCAGGGCATCATGTACACGTATTTTTCTAATACGGTCCTGCTGCGGAGCGAGGACGCCATCCACGACGTCTCCGAGCGCGCCGTCTGTGCGCACATCACGCTCTACCACCTGCTGGTGGGCTGCAACTACCAGGAGCTGCTGGCCGACCTGCTCAACTCGCTCGTGTCGCGCGAGAAGTGCCCGGTGGTAGGCGTTGTGGCGCGCGACAAGAAGGTGGGCCGTCACGGCGTGATCGATATCGAGAAAGACGTGATCACACAC
TRN  10010101100011010
//