EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03295 - Pox_TAA1)
FAM  PF03295
PID  Pox_TAA1
DES  Poxvirus trans-activator protein A1
IPR  IPR004975
ANO  4
ALN  109
AID  0.569306
APH  ((Q9Q8L1_9POXV/43-149:0.14885,VLTF2_VARV/43-150:0.28345):0.19262,O11355_MCV1/1-108:0.42997,VLTF2_FOWPV/43-151:0.50739);
ATP  ((Q9Q8L1_9POXV/43-149,VLTF2_VARV/43-150),O11355_MCV1/1-108,VLTF2_FOWPV/43-151);
ATL  1.56228
DNO  4
DLN  327
DID  0.548532
DPH  ((Q9Q8L1_9POXV/43-149:5.22167,VLTF2_VARV/43-150:11.22450):10.26911,O11355_MCV1/1-108:20.18530,VLTF2_FOWPV/43-151:14.91582);
DTP  ((Q9Q8L1_9POXV/43-149,VLTF2_VARV/43-150),O11355_MCV1/1-108,VLTF2_FOWPV/43-151);
DTL  61.8069
RID  0.569306
RPH  ((Q9Q8L1_9POXV/43-149:0.14885,VLTF2_VARV/43-150:0.28345):0.19262,O11355_MCV1/1-108:0.42997,VLTF2_FOWPV/43-151:0.50739);
RTP  ((Q9Q8L1_9POXV/43-149,VLTF2_VARV/43-150),O11355_MCV1/1-108,VLTF2_FOWPV/43-151);
RTL  1.56228
LNK  O11355_MCV1/1-108:O11355:U86931
LNK  Q9Q8L1_9POXV/43-149:Q9Q8L1:AF170726
LNK  VLTF2_FOWPV/43-151:O72910:AJ005163
LNK  VLTF2_VARV/43-150:P33814:X69198
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  VLTF2_FOWPV/43-151
ASQ  LEIRKDKDNCWFCKQDMNTYNPYFIETLYGDHIGVFCSKICRDSFANMIKSVIALREEPKISLLPLELYEKPEEVLEVINDLRHKEGIYGSCILESDKNIIKLTLRCHC
DSQ  CTCGAAATACGTAAAGATAAAGATAATTGCTGGTTCTGTAAACAAGATATGAATACATATAATCCCTATTTTATAGAGACTCTATACGGTGATCATATAGGGGTATTTTGTTCCAAAATTTGTAGGGATTCTTTCGCTAACATGATAAAAAGTGTAATAGCTTTACGAGAAGAACCTAAAATATCTCTTCTGCCGTTGGAACTATATGAAAAGCCGGAAGAAGTATTAGAAGTAATCAACGATCTAAGACACAAAGAAGGAATATATGGAAGCTGTATACTTGAATCCGACAAAAATATCATTAAATTAACACTAAGATGCCATTGT
TRN  10010101100011010
NAM  O11355_MCV1/1-108
ASQ  MQVNSERARCWFCSQAVGAAA-WAIETLHGHAVGSFCSRICRDSFASTVRTHVALREEPKVTLLPLVFFQHPEKVLELIRSLRSREGIYGTCFFDERAGAVTLTLRSLH
DSQ  CTGCAGGTCAACTCCGAGCGCGCGCGCTGCTGGTTCTGCTCGCAGGCGGTGGGCGCCGCGGCC---TGGGCCATCGAAACTCTGCACGGGCACGCCGTGGGCAGCTTCTGCTCGCGCATCTGCCGCGACTCCTTTGCGAGCACTGTACGCACGCACGTGGCGCTGCGCGAGGAGCCCAAGGTCACGCTGTTGCCGCTGGTCTTTTTCCAGCATCCCGAGAAGGTGCTCGAGCTCATCCGCTCGCTGCGCTCGCGCGAGGGCATCTACGGAACCTGCTTCTTCGACGAGCGCGCGGGGGCGGTCACGCTCACGCTGCGCAGCCTGCAT
TRN  11011111101111111
NAM  Q9Q8L1_9POXV/43-149
ASQ  IPVNTNTVTCWFCKQDLIVVP-LRVETLKG-QVGYFCSRICRDSFAAMIKTHVALREEPKITLLPLVFYNKPEEVINIINSLRNKDGVYGSCFYKENDQSVQISLRSLL
DSQ  ATACCCGTCAATACAAACACCGTAACGTGTTGGTTTTGTAAACAGGATTTAATCGTAGTACCT---TTGCGTGTAGAAACGCTGAAGGGA---CAAGTGGGATATTTTTGTTCGAGGATATGCAGAGATTCGTTCGCCGCCATGATTAAGACGCATGTCGCTTTGCGGGAGGAACCAAAAATAACCCTACTGCCTCTAGTATTTTACAACAAACCGGAAGAGGTCATTAATATAATAAACTCATTGAGAAATAAAGACGGTGTGTACGGTAGTTGTTTTTATAAAGAAAACGATCAATCCGTTCAAATTTCGCTACGTAGTTTGCTG
TRN  10010101100011000
NAM  VLTF2_VARV/43-150
ASQ  IKTNSVIDKCWFCNQDLVFRP-ISIETFKGGEVGYFCSKICRDSLASMVKSHVALREEPKISLLPLVFYEDKEKVINTINLLRDKDGVYGSCYFKENSQIIDISLRSLL
DSQ  ATTAAGACAAATAGTGTAATTGATAAGTGTTGGTTTTGTAATCAAGATTTGGTTTTTAGACCT---ATTAGTATTGAGACATTCAAGGGTGGCGAAGTTGGGTATTTCTGTTCTAAAATATGTAGGGATTCGTTGGCGTCTATGGTTAAGTCTCACGTAGCTCTTAGAGAAGAACCAAAAATTTCTTTGTTGCCTTTAGTATTTTATGAAGATAAGGAAAAGGTCATAAATACAATAAACTTACTAAGAGATAAAGACGGCGTTTACGGAAGTTGTTACTTTAAGGAAAACTCACAAATTATAGATATTTCTCTACGGAGTTTATTG
TRN  10010101110011000
//