EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03284 - PHZA_PHZB)
FAM  PF03284
PID  PHZA_PHZB
DES  Phenazine biosynthesis protein A/B
IPR  IPR004964
ANO  3
ALN  162
AID  0.647018
APH  (O69752_PSEAE/1-162:0.34162,PHZB_PSEFL/1-162:0.24142,PHZA_PSEFL/1-162:0.16353);
ATP  (O69752_PSEAE/1-162,PHZB_PSEFL/1-162,PHZA_PSEFL/1-162);
ATL  0.74657
DNO  3
DLN  486
DID  0.659122
DPH  (O69752_PSEAE/1-162:0.34926,PHZB_PSEFL/1-162:0.20524,PHZA_PSEFL/1-162:0.15210);
DTP  (O69752_PSEAE/1-162,PHZB_PSEFL/1-162,PHZA_PSEFL/1-162);
DTL  0.7066
RID  0.647018
RPH  (O69752_PSEAE/1-162:0.34162,PHZB_PSEFL/1-162:0.24142,PHZA_PSEFL/1-162:0.16353);
RTP  (O69752_PSEAE/1-162,PHZB_PSEFL/1-162,PHZA_PSEFL/1-162);
RTL  0.74657
LNK  O69752_PSEAE/1-162:O69752:AF005404
LNK  PHZA_PSEFL/1-162:Q51787:L48616
LNK  PHZB_PSEFL/1-162:Q51788:L48616
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  O69752_PSEAE/1-162
ASQ  MNGQRYRETPLDIERLRRLNRATVERYMAMKGAERLQRHSLFVEDGCAGNWTTESGEPLVFRGHESLRRLAEWLERCFPDWEWHNVRIFEAEDPNHFWVECDGRGKALVPGYPQGYCENHYIHSFELENGRIKRNREFMNPIQKLRALGIAVPQIKRDGIPT
DSQ  ATGAACGGTCAGCGGTACAGGGAAACACCCCTCGACATCGAGCGTCTGCGGCGCCTGAATCGCGCCACGGTGGAGCGCTACATGGCAATGAAGGGGGCCGAACGGTTACAGCGGCACAGCCTGTTCGTCGAGGACGGCTGCGCCGGCAACTGGACCACGGAAAGCGGCGAACCCCTGGTTTTCCGGGGCCATGAGAGCCTCAGGCGGCTCGCCGAGTGGCTCGAGCGCTGCTTCCCCGACTGGGAGTGGCACAACGTGCGGATCTTCGAGGCCGAGGATCCGAACCACTTCTGGGTCGAGTGCGACGGGCGCGGCAAGGCGCTGGTCCCGGGGTATCCGCAGGGCTATTGCGAGAACCACTACATCCATTCCTTCGAACTCGAGAACGGCCGGATAAAACGTAATCGCGAGTTCATGAACCCGATACAGAAACTGCGTGCATTGGGAATAGCCGTTCCGCAAATAAAACGTGACGGTATTCCCACT
TRN  10010101100011010
NAM  PHZB_PSEFL/1-162
ASQ  MPDSTVQQPITDDTELRRKNRATVEQYMRTKGQDRLRRHELFTEDGSGGLWTTDTGAPIVISGKAKLAEHAVWSLKCFPDWEWYNVKVFETDDPNHIWVECDGHGKILFPGYPEGYYENHFLHSFELQDGKVKRNREFMNVFQQLRALGIPVPHIKREGIPA
DSQ  ATGCCTGATAGCACAGTGCAACAACCCATCACTGACGATACGGAACTACGCCGCAAGAATCGCGCCACGGTTGAACAATACATGCGCACCAAAGGCCAGGACCGCCTGCGCCGGCATGAACTGTTTACCGAAGACGGTTCAGGCGGCTTATGGACCACCGACACGGGTGCGCCGATTGTAATCAGTGGCAAAGCCAAGTTGGCCGAACATGCTGTTTGGTCACTCAAGTGCTTCCCGGATTGGGAATGGTACAACGTCAAGGTATTTGAAACCGATGACCCCAACCATATCTGGGTCGAGTGTGATGGCCACGGCAAGATTCTCTTTCCTGGTTACCCGGAGGGTTATTACGAAAACCACTTCCTGCACTCCTTCGAGCTGCAAGACGGCAAAGTAAAACGCAATCGCGAATTCATGAATGTCTTTCAACAATTGCGCGCCCTGGGTATTCCAGTGCCGCACATCAAGCGTGAAGGCATTCCTGCC
TRN  11011101101011000
NAM  PHZA_PSEFL/1-162
ASQ  MPGSLSSGGFNDHLELRRKNRATVDQYMRTNGEDRLRRHELFTPDGSGGSWNTETGEPLVFKGHAKLAALGVWLHQCFPDWQWHNVRVFETDNPNHFWVESDGRGTTRVPGYPEGYCENHYIHSFELDNGKITQNREFMNPFEQLRALGIPVPKIKREGIPA
DSQ  ATGCCCGGTTCGCTTTCATCTGGCGGCTTTAATGACCATCTTGAACTTCGCCGAAAAAACCGCGCCACGGTTGATCAGTACATGCGCACCAACGGCGAAGATCGCCTGCGCCGCCATGAGTTATTCACGCCGGATGGCAGTGGCGGCTCCTGGAACACCGAAACCGGTGAACCCCTTGTCTTTAAGGGGCACGCGAAGCTGGCCGCACTCGGCGTATGGCTGCACCAGTGCTTCCCGGACTGGCAATGGCACAACGTCCGGGTGTTTGAAACCGACAACCCCAACCACTTCTGGGTGGAAAGTGACGGCCGCGGCACCACTCGAGTTCCTGGTTACCCGGAAGGTTATTGCGAAAACCATTACATCCACTCCTTCGAGTTGGACAACGGCAAGATCACGCAAAACCGTGAATTCATGAACCCGTTTGAACAACTTCGCGCCTTGGGCATCCCGGTGCCAAAAATCAAGCGTGAAGGTATCCCCGCC
TRN  11011101101011000
//