EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03274 - Foamy_BEL)
FAM  PF03274
PID  Foamy_BEL
DES  Foamy virus BEL 1/2 protein
IPR  IPR004956
ANO  4
ALN  267
AID  0.362266
APH  ((BEL1_SFV3L/28-242:0.40751,BEL1_SFV1/30-245:0.35868):0.62708,BEL1_FOAMV/1-205:0.14802,P89873_FOAMV/29-285:1.27511);
ATP  ((BEL1_SFV3L/28-242,BEL1_SFV1/30-245),BEL1_FOAMV/1-205,P89873_FOAMV/29-285);
ATL  2.81642
DNO  2
DLN  801
DID  0.380259
DPH  (P89873_FOAMV/29-285:0.48209,BEL1_SFV1/30-245:0.85670);
DTP  (P89873_FOAMV/29-285,BEL1_SFV1/30-245);
DTL  1.33879
RID  0.229592
RPH  (P89873_FOAMV/29-285:1.86729,BEL1_SFV1/30-245:0.51722);
RTP  (P89873_FOAMV/29-285,BEL1_SFV1/30-245);
RTL  2.38452
LNK  BEL1_FOAMV/1-205:P14353:
LNK  BEL1_SFV1/30-245:P29169:M74039
LNK  BEL1_SFV3L/28-242:P27402:
LNK  P89873_FOAMV/29-285:P89873:U21247
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  P89873_FOAMV/29-285
ASQ  ENAGEGELTIAEEPEENPRRPRRYTKREVKC------VSYH-AYKEIEDKHPQHIKLQDWIPTPEEMIAQKVQNQDLGTILSFDVTCLKSITSLGRNDPGDDPSIMSHVLPVVTPWPMSQDHYAPTLFGILDRYYQGYLKSPATYQTWKFTCQVDPSGKRFMETQFWVP--PL-GQVNIQFYKNYQILTCCQAVDPFANIFHGTDEEMFDIDSGPDVWCSPSLCFKVIYEGAMGQKQEQKTWLCRLGHGHRMGACDYRKVDLYAMRQ
DSQ  GAAAATGCCGGAGAGGGAGAGCTGACTATTGCTGAGGAACCTGAAGAAAATCCTCGACGCCCCAGACGATATACCAAAAGAGAAGTCAAATGT------------------GTGTCTTATCAT---GCATATAAAGAAATTGAGGACAAACATCCTCAACATATTAAACTGCAGGATTGGATCCCCACACCAGAGGAAATGATTGCTCAGAAGGTCCAAAACCAAGACCTAGGCACGATCCTGTCCTTCGATGTGACATGTTTGAAAAGCATCACAAGCCTCGGCAGAAACGACCCAGGAGACGATCCATCGATAATGAGTCATGTGCTTCCAGTAGTGACACCATGGCCAATGAGCCAGGATCACTATGCACCAACCCTCTTTGGAATCCTGGACCGCTACTATCAGGGCTACTTGAAGAGTCCAGCAACCTACCAAACTTGGAAGTTCACATGTCAGGTGGACCCTTCTGGGAAGAGGTTTATGGAGACTCAATTTTGGGTCCCC------CCTCTG---GGTCAGGTGAACATTCAGTTTTATAAGAATTATCAGATTCTAACTTGCTGTCAGGCTGTAGACCCATTTGCTAATATTTTTCATGGTACTGATGAAGAAATGTTTGACATTGATTCAGGTCCTGATGTTTGGTGTTCTCCCTCTTTGTGTTTCAAGGTAATTTATGAAGGGGCAATGGGCCAAAAGCAAGAACAAAAAACCTGGCTGTGCAGACTAGGACATGGTCATCGTATGGGAGCATGCGATTACCGTAAGGTAGATCTGTATGCAATGAGACAA
TRN  10010101100011001
NAM  BEL1_FOAMV/1-205
ASQ  LLLRNLK--------ENPRRPRRYTKREVKC------VSYH-AYKEIEDKHPQHIKLQDWIPTPEEMSKS---------------LCKRLIL-CGLYSAEKASEILR--MPFTVSWEQSDTDPDCFIVSYTCIFCDAVIHDPMPIR-W------DP------EVGIWVKYKPLRGIVGSAVFIMHKHQRNCSLVKPSTSCSEGPK---------PRPRHDPVLRCD-MFEKHHKPRQKRP----RR-RSIDNESCAS-SSDTMVNEP
NAM  BEL1_SFV3L/28-242
ASQ  LDMDQFEPTEG--PDSNPGAEKIYLQLQVAP-GDPSEKTYKFGYEDKEAQNP-DLKMRNWVPDPEKMSKW---------------ACARLIL-CGLYNAKKAKELLK--MDYDIHWEQSKEDSQYFEIEYHCKMCMTVIHEPMPVS-Y------DK------KTGLWIKMGPLRGDIGSVVHTCRRHYERCMSALPSS--GEPLK---------PRVRANPVRRYR-EKSLIVADRPKRS----RWGVAPREQPNTS-SGDAMALMP
NAM  BEL1_SFV1/30-245
ASQ  LELDEMEPKVL--CGENPGDEKLKKQVIKTPPMHPSTVTWHFGYKQKEDQQD-NIKMRDWVPDPSKMSKS---------------TCKRLIL-LGLYQACKAQEIIK--MDYDVHWEKSVVNEQYFEVEYNCKMCRTVLHEPMPIM-Y------DP------ETELWVKPGRLRGPLGSAVYTLKKHYERCLLTLPSL--KGTRL---------PKRRCNPSRRYE-TFREHPPTRKRRS----KEGIPTDQQPSTS-NGDPMALLS
DSQ  CTAGAATTGGATGAAATGGAACCTAAGGTTCTT------TGTGGAGAAAATCCTGGAGATGAAAAATTGAAGAAACAAGTAATTAAAACTCCTCCAATGCATCCTTCTACTGTAACCTGGCATTTTGGATATAAACAAAAGGAAGATCAACAAGAC---AATATAAAAATGAGAGATTGGGTACCAAATCCTTCGAAAATGAGTAAGTCC---------------------------------------------ACATGTAAAAGACTTATTTTG---CTGGGACTATATCAAGCTTGTAAAGCGCAGGAAATTATAAAA------ATGAACTATGATGTACATTGGGAGAAATCTGTAGTTAATGAGCAATATTTTGAAGTAGAATACAATTGTAAAATGTGTAGGACAGTCCTTCATGAACCAATGCCCATAATG---TAT------------------GATCCA------------------GAAACTGAACTTTGGGTAAAGCCAGGACGGCTTAGAGGACCTTTGGGATCTGCTGTTTACACACTTAAAAAACATTATGAACGATGCTTGCTTACTCTTCCCAGCCTC------AAAGGAACTCGACTC---------------------------CCAAAACGTCGCTGTAATCCTAGCAGACGATATGAA---ACATTCAGAGAGCATCCTCCAACTAGGAAGCGGCGCTCC------------AAGGAAGGGATTCCCACTGACCAGCAGCCCTCTACTTCC---AATGGTGACCCCATGGCCCTTCTCTCA
TRN  10010101100011001
//