EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03268 - DUF267)
FAM  PF03268
PID  DUF267
DES  Caenorhabditis protein of unknown function, DUF267
IPR  IPR004950
ANO  7
ALN  366
AID  0.324235
APH  ((((Q9XVJ4_CAEEL/45-398:0.24596,O16244_CAEEL/60-411:0.37043):0.48817,(O16246_CAEEL/33-393:0.34436,O16245_CAEEL/33-364:0.62892):0.30239):0.12760,O44618_CAEEL/25-384:0.44721):1.18385,O45459_CAEEL/19-372:0.28532,O18140_CAEEL/17-370:0.19386);
ATP  ((((Q9XVJ4_CAEEL/45-398,O16244_CAEEL/60-411),(O16246_CAEEL/33-393,O16245_CAEEL/33-364)),O44618_CAEEL/25-384),O45459_CAEEL/19-372,O18140_CAEEL/17-370);
ATL  4.61801
DNO  7
DLN  1098
DID  0.461303
DPH  (Q9XVJ4_CAEEL/45-398:0.23943,(O44618_CAEEL/25-384:0.41131,((O16245_CAEEL/33-364:0.39778,O16246_CAEEL/33-393:0.29804):0.15165,(O18140_CAEEL/17-370:0.18568,O45459_CAEEL/19-372:0.26465):0.67458):0.07708):0.23215,O16244_CAEEL/60-411:0.26988);
DTP  (Q9XVJ4_CAEEL/45-398,(O44618_CAEEL/25-384,((O16245_CAEEL/33-364,O16246_CAEEL/33-393),(O18140_CAEEL/17-370,O45459_CAEEL/19-372))),O16244_CAEEL/60-411);
DTL  3.20223
RID  0.324235
RPH  ((((Q9XVJ4_CAEEL/45-398:0.24596,O16244_CAEEL/60-411:0.37043):0.48817,(O16246_CAEEL/33-393:0.34436,O16245_CAEEL/33-364:0.62892):0.30239):0.12760,O44618_CAEEL/25-384:0.44721):1.18385,O45459_CAEEL/19-372:0.28532,O18140_CAEEL/17-370:0.19386);
RTP  ((((Q9XVJ4_CAEEL/45-398,O16244_CAEEL/60-411),(O16246_CAEEL/33-393,O16245_CAEEL/33-364)),O44618_CAEEL/25-384),O45459_CAEEL/19-372,O18140_CAEEL/17-370);
RTL  4.61801
LNK  O16244_CAEEL/60-411:O16244:AF016420
LNK  O16245_CAEEL/33-364:O16245:AF016420
LNK  O16246_CAEEL/33-393:O16246:AF016420
LNK  O18140_CAEEL/17-370:O18140:Z82055
LNK  O44618_CAEEL/25-384:O44618:AF039047
LNK  O45459_CAEEL/19-372:O45459:Z81531
LNK  Q9XVJ4_CAEEL/45-398:Q9XVJ4:Z81111
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  O16244_CAEEL/60-411
ASQ  LLGPFRFLVKASLLDCSTKS--------KCCSVFTCLLGVVMVVVTLIRISFLMEAVGAPLELGWGEGIFFGYPGLTGFVFSLCLFGWTKNGLIPKFCKRLVRVRMLRQAANSK-LDKFRILHGLALGFSIPWFVAMMSWIIYNFVH-GKVYYGGPEQS-IAKRIFLIISNFYVWFISTVCLAIYIFISAALNREVSYFNEELKKAKEEKTLRNIGVLEKFDFRQNQILEMILFAHESLSSLGGFVPLFMYWGLANGVYLTS---FVYDVPLLYAIIVGFNLASIIFYNVFVMFPAIILQEHLKTTTRILINNDEFECSKDPIVYQTYRIMIDRFQKVNTNISIIASLPITVQTFAACSFVAPNLG
DSQ  TTACTTGGTCCATTCAGATTCCTGGTGAAAGCTTCTTTGCTAGACTGCTCCACAAAATCT------------------------AAGTGTTGTTCTGTTTTCACATGTCTTTTGGGAGTTGTTATGGTTGTGGTAACGCTAATAAGAATCTCATTTTTAATGGAAGCAGTTGGAGCTCCGTTAGAATTAGGATGGGGAGAAGGAATTTTCTTCGGGTATCCTGGTTTAACTGGATTTGTATTTTCCCTATGCCTTTTTGGATGGACTAAAAATGGTTTGATCCCAAAGTTTTGCAAGCGACTGGTTCGGGTTCGAATGTTAAGACAGGCGGCAAACTCAAAA---TTAGATAAATTCCGAATCCTACATGGTCTTGCACTTGGCTTCTCAATTCCTTGGTTTGTAGCAATGATGTCTTGGATAATTTACAATTTTGTTCAT---GGAAAAGTTTATTATGGAGGCCCTGAACAAAGT---ATTGCCAAACGCATCTTCCTTATCATATCCAACTTCTACGTTTGGTTTATTTCTACTGTTTGCCTTGCAATTTACATATTCATCTCGGCCGCTTTAAATCGGGAAGTCAGCTATTTCAATGAAGAGCTGAAAAAAGCCAAAGAAGAAAAAACGCTGAGAAATATTGGTGTTCTGGAGAAATTCGATTTCCGCCAGAATCAGATTCTCGAGATGATCTTGTTTGCTCATGAGTCACTGTCAAGTCTTGGTGGATTTGTTCCGTTGTTCATGTACTGGGGTCTGGCCAATGGCGTCTACCTTACATCA---------TTCGTCTACGACGTGCCTCTTCTCTACGCTATAATAGTTGGCTTCAACCTTGCCTCCATAATCTTCTACAATGTATTCGTTATGTTCCCCGCAATAATTTTACAGGAACATCTGAAAACTACCACGAGAATTTTGATCAATAATGATGAGTTTGAATGCTCAAAAGATCCAATTGTATACCAAACTTATCGTATTATGATTGATCGCTTCCAAAAAGTTAACACTAACATTTCAATTATTGCTTCCCTACCAATAACAGTTCAAACTTTTGCTGCTTGTTCATTTGTAGCTCCAAATTTGGGT
TRN  10010101100011000
NAM  Q9XVJ4_CAEEL/45-398
ASQ  LLGPFRFLIKLTLLDCSTKS--------KCCGLLTTLIAIGIIVALLARVGLLMETDGKPLSFAWAECNFFGFPAIFPALSAVSILSWTKSLFFPNFVKKLIRLRNLRLEPNQK-LDSYGRIHVVALIFSIPWLIAMMSWILYNYVENATIYFGATEESKVIYRVALIISNFYIWFISTVCLAFFVLVFTSINREVSHFNQELEKSKNEKTLKSIGILEKFDFRQNEILELILFANQSLSSFGSVTPLFLFYGLINGVYLTS---FFDDLPTLYKVILGLNLAAIIIYNFIILSTACALQEHLATSTRILINHYEFECSKDSTVYQTYRLMVDRFQKVDTRMYVVSAIPITRSTFAAASFIVPNMG
DSQ  CTGCTTGGACCATTCAGGTTCTTGATTAAACTCACATTGCTAGACTGCTCTACAAAGTCG------------------------AAATGTTGCGGATTGCTCACAACTCTTATAGCAATTGGAATTATTGTAGCGCTTCTCGCAAGAGTTGGTTTGTTGATGGAAACAGATGGAAAACCCCTATCATTCGCGTGGGCAGAATGCAACTTCTTCGGATTCCCTGCCATTTTCCCTGCTCTTAGCGCCGTCTCGATTCTTAGCTGGACTAAGAGCTTATTTTTCCCAAACTTTGTCAAAAAACTAATAAGACTCCGGAACCTACGACTTGAGCCGAACCAAAAG---CTCGATAGTTACGGTAGAATCCACGTGGTTGCGTTGATTTTTTCAATTCCCTGGCTGATTGCAATGATGTCGTGGATTCTCTATAATTATGTGGAGAATGCGACGATATATTTCGGAGCAACCGAAGAGTCAAAAGTTATTTATCGTGTGGCTCTCATTATATCTAATTTCTACATTTGGTTCATTTCTACCGTATGCCTTGCATTTTTCGTACTCGTTTTTACATCTATCAACCGAGAAGTGAGCCATTTCAATCAAGAATTGGAGAAATCCAAGAATGAAAAAACTCTGAAAAGTATCGGGATTCTGGAAAAATTTGATTTCCGTCAAAATGAAATTCTCGAGCTGATTCTGTTTGCAAATCAATCACTCTCCTCTTTCGGATCAGTCACTCCGCTTTTCCTGTTCTACGGACTCATAAACGGCGTCTACTTGACTTCA---------TTTTTCGATGACCTTCCAACTTTATACAAAGTTATCTTGGGACTCAATCTGGCTGCCATTATCATTTACAATTTTATCATTTTATCAACCGCATGTGCTCTTCAGGAACATCTTGCAACCTCTACCAGAATTCTCATAAATCACTATGAATTTGAATGCTCCAAGGATTCAACTGTCTATCAGACTTATCGACTGATGGTAGATCGTTTCCAGAAGGTTGATACTCGGATGTATGTCGTATCGGCAATTCCGATCACAAGAAGTACTTTTGCGGCGGCTTCATTCATTGTTCCGAATATGGGA
TRN  10010101100011000
NAM  O44618_CAEEL/25-384
ASQ  LLGFLKYTTKLTGLDCTACAAAKNGNGSKICGFLARLFSIVVILSMLYRAITFLGEEGKLLTFNWSESNSFGFMGLHAFVCSLCVMGWTANARFPNHIKRLNEVRVLRVEPNEE-IDDYSGFRKKAFFFSLPWLATLVSTALFNALQ-EKILFSGAVVP-AYKYSLFPALAFIVWMTTSTCLAFYALFQFSMVRETEYFNKELQKASEDKKLKDPTVIADFSYRQRELLKLVNETNEFLQSYAKVAPLFCFFSIINAIFNLS---FFSFVPVPYAIMLVFLLACIIGMIILSLLPAAKVQDQIVATSKILMESEDFENAENQKVYQTYRLMVDRSLKSETRIFVVNAFGINSNNLNIAMFVIPNLG
DSQ  CTTCTGGGATTTTTGAAGTATACAACAAAACTAACTGGGCTTGACTGTACGGCTTGTGCGGCTGCGAAAAATGGAAATGGGTCAAAAATTTGCGGATTTTTGGCAAGACTTTTCTCAATTGTCGTGATACTTTCCATGCTCTACCGAGCAATTACATTTCTTGGTGAAGAAGGAAAACTGCTAACATTCAATTGGTCCGAATCCAATTCGTTCGGTTTCATGGGCCTTCACGCGTTTGTCTGCAGTCTGTGTGTTATGGGTTGGACTGCCAATGCTCGTTTTCCAAACCACATTAAGCGGCTGAATGAAGTACGAGTGCTCCGTGTTGAGCCAAATGAAGAA---ATCGATGATTATAGTGGATTCAGAAAGAAAGCCTTCTTTTTCTCGTTACCATGGTTGGCGACACTTGTTTCTACTGCTCTGTTCAATGCTCTCCAA---GAAAAGATCTTATTCTCTGGAGCTGTGGTACCT---GCTTACAAGTACTCTTTGTTCCCGGCTCTTGCATTCATCGTCTGGATGACCACCTCGACATGTCTTGCTTTTTATGCCCTCTTCCAGTTTTCTATGGTCCGCGAGACTGAGTATTTCAACAAGGAATTGCAAAAGGCCAGCGAGGATAAGAAGCTTAAGGATCCCACTGTAATTGCTGACTTCAGTTACCGCCAGAGAGAACTTTTGAAGCTGGTTAATGAAACAAACGAATTCCTTCAAAGCTACGCAAAAGTCGCACCACTTTTCTGCTTCTTCTCCATCATCAATGCCATCTTCAACCTCAGC---------TTCTTTTCCTTTGTCCCCGTTCCATACGCTATTATGTTGGTTTTCCTGTTGGCGTGCATCATCGGAATGATCATTCTCTCTTTGCTACCAGCTGCCAAAGTTCAAGATCAAATTGTTGCAACATCAAAAATTTTGATGGAAAGCGAAGACTTTGAAAATGCGGAAAATCAGAAAGTATACCAAACATATAGGCTCATGGTGGACCGCTCGCTAAAGTCTGAAACGAGAATCTTTGTTGTGAACGCATTTGGAATCAACTCCAACAACTTAAACATTGCCATGTTCGTCATTCCTAACTTGGGT
TRN  10010101100011000
NAM  O16245_CAEEL/33-364
ASQ  FLGPYSIILKFSGLDCSRVSQSKTDNVSRLKSWITQLVPLLIIALTVLRCYTLFQLEARSMSFQWAECSMFAYMGVQSVEYAYSLYSWSKKHFISSHLESLENIRLLRLKDNKN-IDNCLKSHIKIFIWSCLWIVGVMAHAICSSIN-EKIFLSFNDIS--------------------------------LKREIEYFNVELEEAQTTKTLHKSDALQRFCHRQKELIGLVRKANKHLGDYTGTTPIACFNACVNGTYMWFGFHDFPMDSSISSIILKYNIFAVLFITFFSLRPASNVQFQLADTARILMENEEFGKTKDSEVVNTYHTMIDRSLRHTARLRVHGGIPIYPKTVNIAMFFIPMIV
DSQ  TTTTTGGGACCTTATAGTATTATTTTAAAATTCAGCGGGTTAGATTGCTCACGAGTTTCCCAATCTAAAACTGACAATGTGTCACGCCTCAAATCATGGATCACACAACTTGTGCCATTACTCATCATTGCTCTAACCGTTCTGCGATGCTATACACTATTCCAGTTAGAAGCTCGCTCAATGTCTTTTCAATGGGCAGAATGTAGTATGTTCGCGTATATGGGAGTTCAGTCTGTCGAATATGCATATAGTTTGTATAGTTGGAGCAAAAAACATTTTATATCAAGCCATCTTGAGAGTCTGGAGAATATTCGGTTACTTCGGCTGAAAGATAACAAAAAT---ATCGACAATTGTTTAAAGTCTCATATCAAAATTTTTATTTGGTCGTGCTTATGGATAGTCGGTGTAATGGCTCACGCAATATGTAGTTCGATTAAT---GAAAAAATATTTTTAAGCTTTAATGATATTTCA------------------------------------------------------------------------------------------------CTAAAACGAGAAATTGAATATTTCAACGTTGAACTAGAAGAAGCCCAGACAACAAAAACTCTTCATAAGTCTGATGCTCTACAAAGGTTTTGTCACAGACAGAAGGAATTGATTGGTCTAGTCAGAAAAGCGAACAAACATCTGGGAGATTATACTGGGACAACTCCAATTGCATGTTTCAATGCTTGTGTCAATGGTACTTACATGTGGTTTGGGTTTCATGATTTTCCTATGGACTCTTCGATTTCATCAATAATTCTTAAATATAACATATTTGCTGTTTTGTTTATCACATTCTTCTCTCTTCGACCAGCGAGCAATGTGCAATTTCAACTGGCAGACACTGCTCGTATACTAATGGAAAATGAGGAATTCGGAAAAACAAAAGATTCGGAAGTAGTCAATACTTATCACACGATGATTGATAGATCACTCAGGCATACAGCACGGCTCCGAGTTCATGGTGGAATACCTATTTATCCAAAAACTGTCAATATTGCTATGTTTTTTATTCCAATGATTGTT
TRN  10010101100011000
NAM  O16246_CAEEL/33-393
ASQ  LLGPFRKIIKITGLDCSLIARAEFNPSLRIKSILTRIVALVVVAIVFFRMAIYSKAEGACLSLAWAEGNMFQFMALQTIVCALCLFGWTKNSFISKHLGRLEKVRSLRIKENIE-MDNYSNTHRKAFIWSGFYIAAIMSHAIMSSIA-QKILIANKTVI-APLYIAMVFINLLSCFIVAICLIYYFLVNLSLSREIRYFNTELEDAKQGRRLQISGVLSDFCHRQAELIRVVRETNESLQSYATVAPLFAFNSLINAVFIASG--FSSSLPPVVFGVLLFDLFAVIGLTFFTLRPASNVQYDLAQTARILMDSEEFEGSQDVEVFKAYQVMINRSLKHTAHIRVVGAIPIYPTSAHFAFLLIPNLG
DSQ  TTACTTGGACCATTTCGTAAAATTATTAAAATCACCGGACTCGACTGCTCTCTGATTGCTCGTGCCGAGTTCAATCCATCCCTACGAATCAAGTCGATTCTGACAAGAATAGTGGCTTTAGTCGTCGTTGCAATTGTTTTCTTTCGAATGGCAATTTACTCAAAAGCAGAAGGAGCATGTCTATCACTTGCCTGGGCAGAAGGAAACATGTTCCAGTTTATGGCACTTCAAACAATTGTCTGTGCACTTTGTCTTTTTGGATGGACAAAAAATTCGTTTATTTCAAAGCATCTCGGGAGGCTCGAGAAAGTCAGATCTCTACGAATCAAGGAAAATATTGAA---ATGGATAACTACTCCAACACACATCGAAAAGCTTTCATATGGTCTGGATTTTATATTGCGGCGATAATGAGCCATGCAATCATGAGTTCTATAGCT---CAAAAAATTTTAATTGCAAACAAAACAGTCATA---GCTCCCTTGTACATCGCAATGGTTTTTATAAATCTTCTGTCATGTTTCATAGTTGCAATTTGTCTCATTTATTATTTTCTGGTCAATCTTTCTCTGAGTCGAGAAATTCGATATTTTAATACTGAATTGGAAGACGCAAAACAAGGAAGACGCCTACAGATTTCTGGAGTTTTATCTGATTTCTGTCATCGACAAGCAGAATTGATCCGCGTTGTTAGAGAAACCAATGAATCGCTGCAGAGTTATGCTACTGTTGCTCCGTTATTTGCATTCAATAGTTTAATTAATGCAGTTTTTATTGCCAGTGGA------TTCAGCAGTTCACTTCCCCCTGTCGTTTTTGGCGTACTTCTTTTTGATTTGTTCGCTGTAATTGGCCTAACATTCTTCACACTGCGACCAGCTAGCAATGTCCAATACGACCTAGCTCAGACAGCCAGAATACTGATGGACAGCGAAGAATTCGAAGGATCACAGGACGTAGAAGTATTCAAGGCTTATCAAGTGATGATCAACAGATCTCTGAAGCATACTGCCCATATTCGAGTTGTTGGAGCCATTCCAATTTATCCAACAAGTGCTCATTTTGCCTTCCTTCTTATTCCAAATTTGGGA
TRN  10010101100011000
NAM  O18140_CAEEL/17-370
ASQ  IFGFFRYLLRVSPYNCSRSN--------PIRFLFVIFSLLSFLALIFRAYWMFFQISSTILSLGWAERNLYAFISMESFSCVIALYRMTTVGSLEKFEQSLANLKRMRVTGYHESHDEYGKLRLKIFLLKTPIPVFFIATAIYLVVK-QKIIVDTTTHN-NWYYFFDAGVMALCAYVNFLFLPIHALIQNAIAREFHVFNEELEGASKNKELLNPAIFQTFADRQIKMFEYTNALTTRLMPFMSSAPFLILTALANVTFIFTN--LGSLIDTYYYICMIGLMICCIIISSNLMYPPALVQEAMLHTSTVLMDDQYVHHSKDPQIYTTYRSMVDRSINNRTVNLVVQIFSVNRKNIERAYFVITNIV
DSQ  ATTTTTGGCTTTTTCCGTTACTTGCTCCGTGTTTCCCCTTACAATTGCTCCCGGAGCAAC------------------------CCTATACGGTTTCTATTCGTGATTTTTTCTTTGCTATCGTTTTTGGCATTGATTTTCCGCGCTTATTGGATGTTTTTTCAGATTAGTTCTACGATTTTATCCCTCGGCTGGGCTGAAAGAAACCTCTACGCCTTTATATCAATGGAATCCTTTTCCTGTGTCATTGCTCTTTACCGAATGACAACCGTCGGCTCACTGGAAAAATTCGAGCAAAGTTTGGCCAACTTGAAGAGAATGAGAGTCACTGGGTACCATGAGAGTCACGATGAGTACGGCAAGCTTCGGCTGAAAATTTTTCTTCTCAAAACTCCGATTCCTGTGTTTTTCATTGCCACTGCTATTTATTTGGTTGTTAAG---CAAAAGATTATAGTTGATACCACAACTCACAAC---AACTGGTACTACTTTTTCGACGCAGGAGTCATGGCTCTTTGTGCATACGTGAACTTTCTTTTCCTGCCAATTCATGCATTAATACAAAATGCAATTGCTAGAGAATTCCATGTTTTCAATGAGGAATTGGAAGGTGCATCGAAGAATAAGGAATTGTTGAACCCTGCAATTTTCCAAACATTTGCCGACCGTCAGATCAAAATGTTCGAATACACAAATGCACTAACCACCCGGCTTATGCCTTTCATGAGTTCTGCTCCGTTTTTAATATTGACTGCTCTGGCTAATGTAACTTTTATTTTCACAAAT------TTGGGCTCCTTAATAGACACATACTACTACATTTGTATGATTGGATTAATGATTTGTTGCATTATAATTTCTTCTAATTTGATGTATCCACCAGCTTTGGTTCAAGAAGCGATGCTCCACACCTCCACAGTCCTTATGGACGACCAGTATGTCCATCATTCCAAAGATCCACAAATCTACACTACCTACCGCAGTATGGTGGATCGATCAATCAATAATCGCACAGTCAACCTAGTTGTCCAAATTTTCAGTGTGAATCGGAAAAATATTGAGAGAGCTTATTTTGTTATAACTAATATTGTG
TRN  10010101100011000
NAM  O45459_CAEEL/19-372
ASQ  IFGVYPYLLKFSPFNCEKSN--------PLRFVFMIFSFITFLAMVFRAGYMLFYLDVKALTLGFAEQNLYGFISMESFCLVIALFKITKVGRLRKVEQKLAEMREMRITSFHESHDKYWKLWIELFIFNSFNLVLFIGTAIYLLCN-RVIIVGTKTKS-SWYYYFDAPVMILCAYANFLHLPIHELIHTAFAREFRVFNDELENASKNKELLNPQTFQRFADRQIKMFECINPLTERMNRLMAFAPLFILTALTNVLYLVTN--LRSATHTLYFICMVGMLISCIIISKILLYPPALVQEAMLHTSTVLMNDQFIHHSKDPQIYSIYRTMVDRSMHNRSVNVVIRIFDVNRKNIERAYFIISNIV
DSQ  ATTTTTGGAGTTTATCCATATCTTCTGAAGTTTTCACCTTTTAATTGCGAAAAGTCAAAT------------------------CCTTTGAGATTTGTTTTTATGATTTTTTCATTCATCACATTCTTGGCGATGGTTTTTCGAGCAGGATATATGCTTTTTTATCTCGATGTGAAGGCTCTCACATTAGGATTTGCCGAGCAAAACCTATACGGTTTCATTTCGATGGAATCATTCTGTCTTGTCATTGCTCTTTTTAAAATAACAAAAGTTGGGCGACTGAGAAAAGTGGAACAAAAACTCGCAGAAATGCGTGAGATGAGGATAACCTCCTTCCACGAATCTCACGACAAGTATTGGAAACTGTGGATTGAACTTTTCATCTTCAATAGTTTTAACCTCGTGCTTTTCATTGGAACGGCCATCTACTTACTTTGCAAT---AGAGTTATTATTGTTGGAACTAAAACCAAAAGC---TCCTGGTACTATTATTTCGATGCTCCGGTTATGATTCTTTGTGCATATGCAAACTTCCTTCATCTCCCAATTCATGAACTTATTCATACTGCATTTGCAAGAGAATTCCGAGTTTTCAATGATGAACTAGAGAACGCTTCGAAGAATAAAGAATTGCTTAACCCTCAAACTTTCCAAAGATTTGCCGATCGTCAAATTAAAATGTTCGAATGCATAAATCCATTGACCGAACGAATGAATCGACTTATGGCCTTTGCACCACTTTTCATACTTACTGCTCTAACAAACGTGCTGTACCTTGTGACAAAC------TTGAGATCTGCAACTCATACATTATACTTCATTTGCATGGTCGGAATGCTGATATCATGTATTATAATATCAAAGATTCTTCTCTATCCTCCAGCTTTAGTTCAGGAAGCTATGCTCCACACGTCTACTGTTCTTATGAACGACCAATTCATTCACCATTCCAAGGATCCTCAAATCTACAGTATCTACCGTACCATGGTTGATCGATCGATGCACAATCGATCTGTGAATGTCGTAATACGAATATTCGATGTGAATCGGAAGAACATCGAAAGAGCCTATTTTATTATATCAAACATTGTG
TRN  10010101100011000
//