EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03260 - Lipoprotein_11)
FAM  PF03260
PID  Lipoprotein_11
DES  Lepidopteran low molecular weight (30 kD) lipoprotein
IPR  IPR004943
ANO  6
ALN  259
AID  0.496926
APH  (((VITM_MANSE/1-249:0.36406,LP3_BOMMO/6-254:0.42427):0.08125,LP1_BOMMO/9-256:0.53679):0.09878,(L302_BOMMO/6-263:0.10144,LP2_BOMMO/6-264:0.13622):0.32214,Q05432_BOMMO/6-261:0.41092);
ATP  (((VITM_MANSE/1-249,LP3_BOMMO/6-254),LP1_BOMMO/9-256),(L302_BOMMO/6-263,LP2_BOMMO/6-264),Q05432_BOMMO/6-261);
ATL  2.47587
DNO  6
DLN  777
DID  0.596713
DPH  (((VITM_MANSE/1-249:0.35780,LP3_BOMMO/6-254:0.29970):0.06282,LP1_BOMMO/9-256:0.32337):0.04009,(L302_BOMMO/6-263:0.05744,LP2_BOMMO/6-264:0.09110):0.21494,Q05432_BOMMO/6-261:0.31557);
DTP  (((VITM_MANSE/1-249,LP3_BOMMO/6-254),LP1_BOMMO/9-256),(L302_BOMMO/6-263,LP2_BOMMO/6-264),Q05432_BOMMO/6-261);
DTL  1.76283
RID  0.496926
RPH  (((VITM_MANSE/1-249:0.36406,LP3_BOMMO/6-254:0.42427):0.08125,LP1_BOMMO/9-256:0.53679):0.09878,(L302_BOMMO/6-263:0.10144,LP2_BOMMO/6-264:0.13622):0.32214,Q05432_BOMMO/6-261:0.41092);
RTP  (((VITM_MANSE/1-249,LP3_BOMMO/6-254),LP1_BOMMO/9-256),(L302_BOMMO/6-263,LP2_BOMMO/6-264),Q05432_BOMMO/6-261);
RTL  2.47587
LNK  L302_BOMMO/6-263:Q00801:X54734
LNK  LP1_BOMMO/9-256:P09334:X07552
LNK  LP2_BOMMO/6-264:P09335:X07553
LNK  LP3_BOMMO/6-254:P09336:X07554
LNK  Q05432_BOMMO/6-261:Q05432:D12523
LNK  VITM_MANSE/1-249:P19616:M28820
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q05432_BOMMO/6-261
ASQ  FFSTCVLAASAGLIDLDINILSAPTR-AETRLVDAITTADYNTAVSLILLLEKQSSGSIIEDTVNNLIRDGNRNVLEFAYKLWIGEGKEIVKHYFPVQFRQVLSESNVKIINKRDNLAIKLGAAADSDNDRIAYGDANDKSSENVSWKLIPLWENNRVYFKIYSVRRHQYLKLG--TGTDGENDHSVYGDDRADTHRHQWYLKPAKLDNQVLFYIYNRQYNQALKLSRSVDSDGDRRAYSSSSSVEGQPELFGWSISIL
DSQ  TTTTTCTCGACCTGCGTGCTGGCGGCCAGCGCCGGTCTTATTGACTTGGACATTAACATTCTGTCCGCTCCGACCAGA---GCGGAAACGAGGCTCGTCGATGCTATCACCACTGCCGATTACAACACGGCTGTTTCTCTGATTCTGCTGCTCGAGAAACAATCGAGTGGAAGCATCATCGAGGATACCGTCAACAATCTCATCAGAGACGGCAATAGGAATGTTTTAGAGTTCGCCTACAAACTGTGGATCGGGGAGGGTAAGGAAATCGTCAAACACTACTTCCCTGTTCAGTTTAGACAGGTGTTATCCGAGAGCAACGTCAAGATCATCAACAAGAGAGACAATCTTGCCATCAAACTCGGTGCTGCGGCAGACTCAGATAACGACAGAATCGCATACGGCGATGCCAACGACAAGAGCAGCGAGAACGTCAGCTGGAAGTTGATTCCTCTCTGGGAGAACAACAGGGTTTACTTCAAGATCTACAGTGTTCGTAGGCACCAATACTTGAAACTTGGA------ACGGGTACGGATGGTGAAAACGACCATAGCGTTTATGGAGATGATCGCGCTGACACGCACAGACACCAGTGGTACCTGAAGCCCGCTAAGCTCGACAACCAGGTCCTGTTCTACATCTACAACCGCCAGTACAATCAGGCCTTGAAACTTAGCAGAAGTGTCGACAGCGACGGAGACAGACGCGCGTACTCAAGCTCCAGCAGCGTCGAAGGTCAACCCGAGCTCTTCGGCTGGTCTATCTCAATCCTC
TRN  10010101100011000
NAM  VITM_MANSE/1-249
ASQ  MLRTTVVLLTLAAIAFAAP--------TSDDIYNNVVIGDIDGAVAKSKELQKQGKGDIITEAVNRLIRDSQRNTMEYAYQLWSLEARDIVKERFPIQFRMMLGEHSIKLINKRDNLAMKLGVATDNSGDRIAYGAADDKTSDRVAWKFVPLSEDKRVYFKILNVQRGQYLKLG--VETDSDGEHMAYASSGADTFRHQWYLQPAKADGNLVFFIVNREYNHALKLGRSVDSMGDRQVWGHNGNVIGNPELFGWSVVAF
DSQ  ATGTTGCGGACAACAGTGGTATTATTGACGCTTGCGGCGATTGCCTTTGCCGCACCC------------------------ACCTCCGACGACATATATAACAATGTAGTCATCGGGGACATTGACGGAGCCGTCGCCAAGTCCAAAGAGCTCCAGAAGCAGGGCAAAGGTGACATCATCACTGAGGCAGTCAACAGGTTGATCAGGGACAGCCAGCGAAACACTATGGAATACGCGTACCAACTCTGGAGCCTCGAGGCTAGAGATATCGTTAAAGAACGTTTCCCAATCCAGTTCAGAATGATGTTAGGCGAGCATTCCATTAAACTGATCAACAAGAGAGATAACCTAGCAATGAAACTGGGTGTCGCGACTGATAATTCTGGAGACAGGATCGCGTACGGCGCCGCTGATGATAAAACAAGCGACAGAGTGGCTTGGAAGTTTGTTCCCCTTTCTGAGGACAAGAGAGTATACTTCAAGATCCTGAACGTGCAACGCGGCCAGTACCTGAAGCTTGGC------GTTGAAACCGACAGCGACGGAGAGCACATGGCTTATGCATCCAGTGGAGCCGACACCTTCAGACACCAGTGGTACCTCCAGCCCGCGAAAGCAGATGGGAACCTTGTCTTCTTCATCGTCAATCGGGAGTACAACCACGCGCTGAAGTTGGGCAGGTCTGTAGACTCGATGGGAGACCGTCAGGTGTGGGGACACAATGGAAATGTCATCGGAAACCCTGAACTCTTCGGATGGTCAGTCGTGGCTTTC
TRN  10010101100011000
NAM  L302_BOMMO/6-263
ASQ  VFASCVLAVSAGVAEMSAVSMSSSNKELEEKLYNSILTGDYDSAVRQSLEYENQGKGSIIQNVVNNLIIDGSRNTMEYCYKLWVGNGQHIVRKYFPYNFRLIMAGNFVKLIYRNYNLALKLGPTLDPANERLAYGDGKEKNSDLISWKFITLWENNRVYFKIHNTKYNQYLKLS-STTDCNTQDRVIFGTNTADTTREQWFLQPTKYENDVLFFIYNREYNDALKLGRIVDASGDRMAFGHDGEVAGLPDIFSWFVTPF
DSQ  GTGTTCGCGTCGTGCGTGCTCGCCGTCAGCGCCGGCGTCGCTGAAATGTCCGCGGTAAGCATGAGCAGTTCTAACAAAGAACTCGAGGAGAAACTGTACAACAGCATCCTCACCGGTGACTACGACAGCGCTGTCCGTCAGAGCTTGGAATACGAGAACCAAGGCAAGGGCTCCATCATCCAGAATGTAGTTAACAACCTGATCATTGACGGAAGTCGGAACACCATGGAGTACTGCTACAAGCTGTGGGTCGGCAACGGACAGCACATTGTCAGAAAGTACTTCCCCTATAACTTTAGACTCATCATGGCCGGAAACTTCGTTAAGCTCATTTACAGAAACTACAACCTCGCTCTGAAGCTCGGCCCCACTCTTGATCCCGCGAACGAGAGACTTGCATACGGCGATGGTAAGGAAAAGAACAGCGACCTCATCAGTTGGAAGTTCATTACCTTGTGGGAGAACAACAGAGTGTACTTCAAGATCCACAACACTAAGTACAACCAGTACTTGAAACTAAGT---TCGACGACTGACTGCAACACTCAAGACCGTGTTATATTCGGCACCAACACCGCCGACACCACCAGGGAGCAGTGGTTCCTCCAGCCCACGAAGTACGAAAACGACGTCCTGTTCTTCATCTACAATCGCGAGTACAACGATGCTTTGAAGCTCGGTAGGATTGTGGACGCTTCGGGAGACCGTATGGCATTTGGACACGATGGTGAAGTAGCTGGTCTCCCTGACATCTTCTCCTGGTTCGTTACACCTTTC
TRN  10010101100011011
NAM  LP2_BOMMO/6-264
ASQ  VFAMCVPAASAGVVELSADSMSPSNQDLEDKLYNSILTGDYDSAVRKSLEYESQGQGSIVQNVVNNLIIDKRRNTMEYCYKLWVGNGQDIVKKYFPLSFRLIMAGNYVKLIYRNYNLALKLGSTTNPSNERIAYGDGVDKHTDLVSWKFITLWENNRVYFKAHNTKYNQYLKMSTSTCNCNARDRVVYGGNSADSTREQWFFQPAKYENDVLFFIYNRQFNDALELGTIVNASGDRKAVGHDGEVAGLPDIYSWFITPF
DSQ  GTGTTCGCAATGTGCGTGCCTGCCGCCAGCGCCGGCGTCGTGGAACTATCCGCGGACAGCATGAGCCCTTCTAACCAAGACCTCGAGGACAAACTGTACAACAGCATCCTCACCGGTGACTACGACAGTGCTGTACGTAAGAGCTTGGAATACGAGAGCCAAGGCCAGGGCAGCATCGTTCAAAATGTAGTTAACAATCTGATTATTGACAAGAGACGGAACACCATGGAGTACTGCTACAAGCTGTGGGTCGGCAACGGACAGGATATTGTCAAAAAGTACTTCCCATTAAGCTTTAGACTCATCATGGCCGGAAACTACGTCAAGCTCATTTACAGAAACTACAACCTCGCTCTGAAGCTCGGTTCCACAACCAATCCCTCGAATGAGAGAATTGCCTACGGCGATGGTGTTGACAAGCACACTGACCTCGTCAGTTGGAAGTTCATTACCTTGTGGGAGAACAACAGAGTGTACTTCAAGGCCCACAACACTAAGTACAACCAGTACTTGAAGATGAGTACGTCGACTTGCAACTGCAACGCTCGGGACCGTGTTGTATACGGCGGCAACAGCGCTGACAGCACCAGGGAGCAATGGTTCTTCCAGCCCGCCAAGTACGAAAACGACGTCCTGTTCTTCATCTACAATCGCCAATTCAACGATGCCTTGGAGCTCGGTACGATCGTGAACGCCTCGGGAGACCGCAAGGCCGTTGGACACGATGGTGAAGTCGCCGGTCTTCCTGACATCTACTCGTGGTTCATTACACCTTTC
TRN  10010101100011010
NAM  LP3_BOMMO/6-254
ASQ  VI-LCLFVASLYAADSDV--P---NDILEEQLYNSVVVADYDSAVEKSKHLYEEKKSEVITNVVNKLIRNNKMNCMEYAYQLWLQGSKDIVRDCFPVEFRLIFAENAIKLMYKRDGLALTLSNDVQGDDGRPAYG--KDKTSPRVSWKLIALWENNKVYFKILNTERNQYLVLG--VGTNWNGDHMAFGVNSVDSFRAQWYLQPAKYDNDVLFYIYNREYSKALTLSRTVEPSGHRMAWGYNGRVIGSPEHYAWGIKAF
DSQ  GTTATT---CTATGTCTTTTCGTGGCATCTCTGTATGCTGCAGATTCCGACGTC------CCT---------AACGACATTCTGGAGGAGCAGCTTTACAATAGCGTCGTCGTCGCCGATTACGACAGTGCGGTTGAAAAGAGCAAGCATTTATACGAGGAGAAGAAGAGCGAAGTCATCACAAATGTCGTGAACAAACTGATACGAAACAACAAGATGAACTGCATGGAGTACGCCTATCAACTTTGGCTCCAGGGCTCCAAGGACATCGTCCGGGATTGTTTCCCAGTTGAGTTCAGACTTATCTTCGCCGAAAACGCGATTAAGCTTATGTACAAGCGCGACGGTCTCGCTTTGACGCTGAGCAATGATGTTCAAGGCGACGATGGCAGACCTGCCTACGGC------AAGGACAAGACAAGCCCGAGAGTCAGCTGGAAGTTAATCGCTCTGTGGGAGAACAACAAGGTCTACTTCAAGATCTTGAACACTGAACGTAACCAATACTTGGTATTGGGA------GTCGGCACTAACTGGAACGGCGACCATATGGCCTTCGGAGTCAACAGCGTCGATAGTTTCAGAGCCCAGTGGTACCTGCAGCCTGCTAAGTACGACAATGACGTCTTGTTCTACATCTACAACCGTGAATACAGCAAGGCTTTGACACTGTCGAGGACGGTTGAGCCCTCGGGTCACCGCATGGCCTGGGGATACAACGGCAGAGTAATCGGAAGTCCCGAACATTACGCTTGGGGTATAAAGGCTTTC
TRN  10010101100011010
NAM  LP1_BOMMO/9-256
ASQ  VLAVCALASNATLAPRTD-------DVLAEQLYMSVVIGEYETAIAKCSEYLKEKKGEVIKEAVKRLIENGKRNTMDFAYQLWTKDGKEIVKSYFPIQFRVIFTEQTVKLINKRDHHALKLIDQQN--HNKIAFGDSKDKTSKKVSWKFTPVLENNRVYFKIMSTEDKQYLKLD--NTKGSSDDRIIYGDSTADTFKHHWYLEPSMYESDVMFFVYNREYNSVMTLDEDMAANEDREALGHSGEVSGYPQLFAWYIVPY
DSQ  GTCCTCGCCGTGTGTGCGCTGGCTTCTAACGCCACACTTGCACCAAGAACTGAT---------------------GACGTACTGGCAGAGCAGCTGTATATGAGTGTCGTCATTGGTGAATACGAGACCGCTATCGCCAAATGCTCTGAATATCTGAAGGAAAAGAAGGGAGAGGTTATCAAGGAAGCCGTGAAGCGTCTGATCGAAAACGGCAAGAGGAACACCATGGACTTCGCCTACCAGTTATGGACAAAGGATGGAAAGGAAATCGTCAAATCTTACTTCCCCATCCAGTTTAGAGTGATCTTCACCGAGCAGACTGTCAAGCTCATAAACAAAAGGGACCATCACGCCCTCAAGTTGATCGACCAACAAAAC------CACAACAAAATTGCATTCGGTGACTCCAAAGACAAAACCAGCAAGAAAGTCTCCTGGAAGTTTACCCCCGTGTTGGAAAACAACAGAGTATACTTCAAGATCATGTCCACCGAAGACAAACAGTACCTGAAGCTCGAT------AACACGAAAGGTTCTAGTGATGACCGTATCATCTACGGTGATAGCACCGCTGACACCTTCAAACACCACTGGTACCTTGAGCCCTCCATGTACGAAAGCGACGTCATGTTCTTCGTCTACAACCGAGAGTACAACAGTGTTATGACACTTGATGAAGATATGGCCGCCAACGAAGACCGTGAAGCCTTGGGGCACAGCGGAGAAGTTTCCGGTTATCCCCAACTTTTTGCATGGTACATCGTCCCCTAC
TRN  10010101100011010
//