EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03233 - Cauli_AT)
FAM  PF03233
PID  Cauli_AT
DES  Aphid transmission protein
IPR  IPR004917
ANO  3
ALN  170
AID  0.461107
APH  (VAT_FMVD/1-164:0.78828,VAT_CERV/1-166:0.44395,VAT_CAMVC/1-159:0.40016);
ATP  (VAT_FMVD/1-164,VAT_CERV/1-166,VAT_CAMVC/1-159);
ATL  1.63239
DNO  3
DLN  510
DID  0.541725
DPH  (VAT_FMVD/1-164:0.40144,VAT_CERV/1-166:0.35423,VAT_CAMVC/1-159:0.39616);
DTP  (VAT_FMVD/1-164,VAT_CERV/1-166,VAT_CAMVC/1-159);
DTL  1.15183
RID  0.461107
RPH  (VAT_FMVD/1-164:0.78828,VAT_CERV/1-166:0.44395,VAT_CAMVC/1-159:0.40016);
RTP  (VAT_FMVD/1-164,VAT_CERV/1-166,VAT_CAMVC/1-159);
RTL  1.63239
LNK  VAT_CAMVC/1-159:P03549:V00140
LNK  VAT_CERV/1-166:P05397:X04658
LNK  VAT_FMVD/1-164:P09521:X06166
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  VAT_FMVD/1-164
ASQ  MSKDHLDFPHVYKKNKVLKLKPLDLSKNPRSYYFSSQNGSIQAIINHCNNINQITARNWLKLSKVLSYFGLEKDTSDSISKNKSPFNRFLKDISHIFREGEGSTKKASELGEILEKIKN---LDLKIENLN---KRIPDNLVTKALIKELVKDFDERLTEVRDDIKKVIG
DSQ  ATGAGTAAAGATCACTTAGACTTTCCTCACGTCTACAAAAAGAACAAAGTTCTTAAGTTAAAACCCTTAGATTTGTCAAAAAATCCTAGGAGTTATTACTTTAGCAGCCAAAATGGTAGTATTCAAGCTATTATTAATCACTGCAATAATATTAATCAGATAACAGCACGAAACTGGTTAAAACTAAGCAAAGTATTATCATATTTTGGTCTAGAAAAAGACACTAGTGATAGTATAAGCAAAAATAAAAGCCCGTTTAACAGGTTTTTAAAAGATATCTCTCACATTTTCAGAGAGGGGGAAGGAAGTACTAAAAAAGCTTCTGAACTAGGAGAAATCTTAGAAAAAATTAAGAAT---------TTAGACCTAAAAATCGAAAATCTTAAT---------AAAAGAATACCAGACAACTTGGTAACAAAAGCCTTAATTAAGGAATTAGTCAAAGACTTTGACGAAAGACTTACAGAAGTCAGAGATGACATTAAGAAAGTCATAGGA
TRN  10010101110011000
NAM  VAT_CERV/1-166
ASQ  MS--LTTYPHIYKKEQILKLKRLNKLSNDRKFFFSSVKGTLPGIISHCNNINEILGRCYLGICKLNSFFGLSKDPSDKLSVSKSPS--VYTLPSKIFKEGGGNGDNTTTQTDILKNAQDQVILSKKIDELQTQVKELSSKIEPEPLTKEDIKKTYETLSRIESGLKGIIG
DSQ  ATGAGT------TTAACTACCTATCCTCATATCTATAAGAAAGAGCAAATTCTTAAGCTTAAGCGGCTTAATAAGCTCTCAAATGACAGAAAGTTCTTCTTTAGCTCTGTTAAAGGAACTTTACCTGGCATAATAAGCCACTGCAACAATATCAATGAGATATTAGGCAGATGTTATTTAGGAATCTGTAAGCTAAATTCATTCTTTGGATTAAGCAAAGACCCTAGTGACAAATTAAGTGTTAGTAAATCACCGTCA------GTTTACACCTTGCCTTCCAAAATCTTTAAGGAGGGGGGAGGAAATGGTGACAACACAACAACACAGACAGATATACTGAAAAATGCTCAAGATCAGGTCATCTTAAGCAAAAAGATTGATGAACTTCAAACTCAGGTTAAGGAACTCTCTAGTAAAATAGAACCAGAACCCCTAACCAAAGAAGACATCAAGAAAACCTATGAAACCTTATCCAGGATAGAATCCGGCCTAAAAGGAATTATAGGA
TRN  10010101100011000
NAM  VAT_CAMVC/1-159
ASQ  MS--ITGQPHVYKKDTIIRLKPLSLNSNNRSYVFSSSKGNIQNIINHLNNLNEIVGRSLLGIWKINSYFGLSKDPSE--SKSKNPS--VFNTAKNIFKSRGVDYSSQLKEVKSLLEAQN-----TRIKNLENAIQSLDNKIEPEPLTKEEVKELKESINSIKEGLKNIIG
DSQ  ATGAGC------ATTACGGGTCAACCGCATGTTTATAAAAAGGATACTATTATTAGACTAAAACCATTGTCTCTTAATAGTAATAATAGAAGTTATGTTTTTAGTTCCTCAAAAGGGAACATTCAAAATATAATTAATCATCTTAACAACCTCAATGAGATTGTAGGAAGAAGCTTACTCGGAATATGGAAGATCAACTCATACTTCGGACTAAGCAAAGACCCTTCGGAG------TCCAAATCAAAAAACCCGTCA------GTTTTTAATACTGCAAAAAACATTTTTAAGAGTAGGGGGGTTGATTACTCGAGCCAACTAAAGGAAGTAAAATCCCTTTTAGAAGCTCAAAAT---------------ACTAGAATTAAAAATCTAGAAAATGCAATTCAATCCTTAGATAATAAGATTGAACCAGAGCCCTTAACTAAAGAAGAAGTTAAAGAGCTAAAAGAATCGATTAACTCGATCAAAGAAGGATTAAAGAATATTATTGGC
TRN  10010101110011000
//