EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03197 - FRD2)
FAM  PF03197
PID  FRD2
DES  Bacteriophage FRD2 protein
IPR  IPR004885
ANO  4
ALN  104
AID  0.577581
APH  ((Y14D_BPT4/26-128:0.14640,Q37949_BPLZ5/1-103:1.00442):0.20084,Q38547_9VIRU/27-121:0.13315,Q37934_BPK3/27-126:0.14590);
ATP  ((Y14D_BPT4/26-128,Q37949_BPLZ5/1-103),Q38547_9VIRU/27-121,Q37934_BPK3/27-126);
ATL  1.63074
DNO  4
DLN  312
DID  0.677787
DPH  ((Y14D_BPT4/26-128:0.10297,Q37949_BPLZ5/1-103:0.58228):0.15455,Q38547_9VIRU/27-121:0.05299,Q37934_BPK3/27-126:0.07159);
DTP  ((Y14D_BPT4/26-128,Q37949_BPLZ5/1-103),Q38547_9VIRU/27-121,Q37934_BPK3/27-126);
DTL  0.96438
RID  0.577581
RPH  ((Y14D_BPT4/26-128:0.14640,Q37949_BPLZ5/1-103:1.00442):0.20084,Q38547_9VIRU/27-121:0.13315,Q37934_BPK3/27-126:0.14590);
RTP  ((Y14D_BPT4/26-128,Q37949_BPLZ5/1-103),Q38547_9VIRU/27-121,Q37934_BPK3/27-126);
RTL  1.63074
LNK  Q37934_BPK3/27-126:Q37934:L46833
LNK  Q37949_BPLZ5/1-103:Q37949:L46837
LNK  Q38547_9VIRU/27-121:Q38547:L46832
LNK  Y14D_BPT4/26-128:P39507:AF158101
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q37934_BPK3/27-126
ASQ  SIVKAIRDNGGWFEVKEVSVAN-GYKAVKHIECANGKHFYLKDR---LLEICEDEFHCFREYKEPTSEKDEVKDPVSGVTKIHCIVDENNVDEIIELLRKTFKK
DSQ  TCAATAGTTAAAGCCATTCGAGATAATGGCGGATGGTTTGAAGTTAAAGAAGTTTCCGTCGCTAAC---GGATATAAAGCAGTAAAACACATTGAATGCGCAAATGGAAAGCATTTTTACCTCAAAGATAGA---------CTTTTAGAAATTTGCGAAGACGAATTTCATTGTTTTCGCGAGTATAAAGAACCGACTTCTGAAAAAGACGAAGTCAAAGACCCGGTTTCTGGCGTAACAAAAATTCACTGCATTGTAGATGAAAACAATGTAGATGAAATCATTGAACTTTTGCGAAAAACTTTCAAAAAG
TRN  10010101110011000
NAM  Q38547_9VIRU/27-121
ASQ  SIVKIIQENGGWFEAKEAFFVD-GFRVIKHIECANGKHFYFN--------VCEDEFHCFREYKEPTSEDDGAEDTVSGVTKIHCIVDENNVDEIIELLRKTFKK
DSQ  TCAATAGTTAAAATTATTCAAGAAAATGGTGGATGGTTTGAAGCTAAAGAAGCTTTCTTTGTTGAT---GGATTTAGAGTAATAAAACACATTGAATGCGCAAATGGAAAGCATTTTTACTTTAAC------------------------GTTTGTGAAGACGAATTTCATTGTTTTCGCGAGTATAAAGAACCGACTTCTGAAGATGATGGAGCCGAAGACACAGTTTCTGGCGTAACAAAAATTCACTGCATTGTAGACGAAAACAATGTAGATGAAATCATTGAACTTTTGCGAAAAACTTTCAAAAAG
TRN  10010101110011001
NAM  Y14D_BPT4/26-128
ASQ  SMVGIIQENGGWFEVKSISSLD-GFDYVTEIICANGEIYNDDGMGDDYFELSEEEFYCFREYKEPTSEEDEVKDKVSGVTKIHCIVDENNVDEIIELLRKTFKK
DSQ  AGTATGGTCGGCATCATTCAAGAAAATGGCGGTTGGTTTGAAGTTAAATCAATATCAAGTTTAGAT---GGCTTTGATTATGTAACCGAAATCATTTGTGCTAATGGTGAAATCTATAATGATGATGGTATGGGTGATGATTATTTTGAACTTAGTGAAGAAGAGTTTTATTGTTTCCGCGAATATAAAGAACCGACTTCTGAAGAAGATGAAGTCAAAGACAAGGTTTCTGGCGTAACAAAAATTCACTGCATTGTTGACGAAAACAATGTAGATGAAATCATTGAACTTTTGCGAAAAACTTTCAAAAAG
TRN  10010101110011000
NAM  Q37949_BPLZ5/1-103
ASQ  MMLNLIEKHGPSFVVDEMESDDCAGECVVRVTMEDGTEYMAGGPLETYFPIYPEEFKYFTEVTLEKPQ-SANEGIVSGVTKIHCIVDENNVDEIIELLRKTFKA
DSQ  ATGATGCTAAATTTAATAGAGAAGCACGGACCTAGTTTTGTTGTAGATGAAATGGAAAGTGATGATTGTGCTGGTGAATGTGTGGTACGTGTAACTATGGAAGATGGTACTGAATACATGGCGGGTGGCCCACTTGAGACGTATTTTCCGATTTACCCTGAAGAATTCAAATACTTTACTGAGGTAACTTTAGAAAAGCCTCAA---TCCGCTAATGAAGGTATAGTTTCTGGCGTAACAAAAATTCACTGCATTGTTGACGAAAACAATGTAGATGAAATCATTGAACTTTTGCGAAAAACTTTTAAGGCC
TRN  10010101110011010
//