EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03181 - BURP)
FAM  PF03181
PID  BURP
DES  BURP domain
IPR  IPR004873
ANO  14
ALN  227
AID  0.402672
APH  (((((((RD22_ARATH/174-392:0.31309,((Q8VWQ1_GOSHI/123-335:0.11304,(SVF30_VICFA/66-259:0.54187,Q06765_SOYBN/70-259:0.35233):0.55213):0.03467,(Q94IC6_9ROSI/82-292:0.22721,Q947D4_PRUPE/134-346:0.17305):0.07598):0.08533):0.08324,Q942D4_ORYSA/211-428:0.36141):0.12535,(Q8GSG3_9FABA/190-402:0.35576,Q8RUD9_SOYBN/91-305:0.46114):0.19830):0.13784,O65009_BRANA/58-282:0.80591):0.19858,Q93X11_9POAL/86-301:0.75029):0.80348,P93217_LYCES/412-628:0.10984):0.09896,O64599_ARATH/409-625:0.10200,O80760_ARATH/407-623:0.15672);
ATP  (((((((RD22_ARATH/174-392,((Q8VWQ1_GOSHI/123-335,(SVF30_VICFA/66-259,Q06765_SOYBN/70-259)),(Q94IC6_9ROSI/82-292,Q947D4_PRUPE/134-346))),Q942D4_ORYSA/211-428),(Q8GSG3_9FABA/190-402,Q8RUD9_SOYBN/91-305)),O65009_BRANA/58-282),Q93X11_9POAL/86-301),P93217_LYCES/412-628),O64599_ARATH/409-625,O80760_ARATH/407-623);
ATL  7.21751
DNO  13
DLN  681
DID  0.504605
DPH  (((((((Q947D4_PRUPE/134-346:0.16315,Q94IC6_9ROSI/82-292:0.18025):0.04358,Q8VWQ1_GOSHI/123-335:0.14100):0.03931,(RD22_ARATH/174-392:0.21620,Q942D4_ORYSA/211-428:0.38637):0.12252):0.10642,((SVF30_VICFA/66-259:0.31726,Q06765_SOYBN/70-259:0.25489):0.24687,O65009_BRANA/58-282:0.58848):0.07549):0.06526,(Q8GSG3_9FABA/190-402:0.23446,Q8RUD9_SOYBN/91-305:0.27490):0.11507):0.65616,P93217_LYCES/412-628:0.17381):0.09677,O64599_ARATH/409-625:0.11450,O80760_ARATH/407-623:0.18125);
DTP  (((((((Q947D4_PRUPE/134-346,Q94IC6_9ROSI/82-292),Q8VWQ1_GOSHI/123-335),(RD22_ARATH/174-392,Q942D4_ORYSA/211-428)),((SVF30_VICFA/66-259,Q06765_SOYBN/70-259),O65009_BRANA/58-282)),(Q8GSG3_9FABA/190-402,Q8RUD9_SOYBN/91-305)),P93217_LYCES/412-628),O64599_ARATH/409-625,O80760_ARATH/407-623);
DTL  4.79397
RID  0.415746
RPH  ((RD22_ARATH/174-392:0.31253,((Q947D4_PRUPE/134-346:0.17641,Q94IC6_9ROSI/82-292:0.22694):0.07377,(Q8VWQ1_GOSHI/123-335:0.11292,(Q06765_SOYBN/70-259:0.35295,SVF30_VICFA/66-259:0.54465):0.55570):0.03535):0.08923):0.06396,((Q8RUD9_SOYBN/91-305:0.47361,Q8GSG3_9FABA/190-402:0.34523):0.19363,(O65009_BRANA/58-282:0.73273,(P93217_LYCES/412-628:0.08929,(O80760_ARATH/407-623:0.15977,O64599_ARATH/409-625:0.10061):0.11978):0.95061):0.15932):0.15084,Q942D4_ORYSA/211-428:0.37830);
RTP  ((RD22_ARATH/174-392,((Q947D4_PRUPE/134-346,Q94IC6_9ROSI/82-292),(Q8VWQ1_GOSHI/123-335,(Q06765_SOYBN/70-259,SVF30_VICFA/66-259)))),((Q8RUD9_SOYBN/91-305,Q8GSG3_9FABA/190-402),(O65009_BRANA/58-282,(P93217_LYCES/412-628,(O80760_ARATH/407-623,O64599_ARATH/409-625)))),Q942D4_ORYSA/211-428);
RTL  6.39813
LNK  O64599_ARATH/409-625:O64599:AC003671
LNK  O65009_BRANA/58-282:O65009:AF049028
LNK  O80760_ARATH/407-623:O80760:AC004473
LNK  P93217_LYCES/412-628:P93217:U64789
LNK  Q06765_SOYBN/70-259:Q06765:X69639
LNK  Q8GSG3_9FABA/190-402:Q8GSG3:AB041817
LNK  Q8RUD9_SOYBN/91-305:Q8RUD9:AF467554
LNK  Q8VWQ1_GOSHI/123-335:Q8VWQ1:AY072821
LNK  Q93X11_9POAL/86-301:Q93X11:
LNK  Q942D4_ORYSA/211-428:Q942D4:AP003560
LNK  Q947D4_PRUPE/134-346:Q947D4:AF319165
LNK  Q94IC6_9ROSI/82-292:Q94IC6:AB062744
LNK  RD22_ARATH/174-392:Q08298:D10703
LNK  SVF30_VICFA/66-259:P09059:X13242
AMK  xxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q942D4_ORYSA/211-428
ASQ  ALFFLEKDLHPGKTMAVHFT-.-ATTAGEKFLPRSEADAMPFSSEKVPEILSRFSVKPGSVEAAEMAQTLRDCEAPPAQGERKACATSLESMVDFATSSLG-TSHVRAASTVVGKEGSPEQEYTV--TAVKRAAAGGDqDQLVACHAEPYAYAVFACHLTRA.TRAYAVSMAGRDGT--GVEAVAVCHADTAGWNPKHVAFQVLKVKPGTVPVCHFLPQDHVVWTRS
DSQ  GCGCTCTTCTTCTTGGAGAAGGACCTCCACCCCGGGAAGACGATGGCCGTACATTTCACG---...---GCCACCACCGCCGGAGAGAAGTTCCTCCCCAGGAGCGAGGCCGACGCCATGCCGTTCTCCTCCGAGAAGGTCCCGGAGATCCTCAGCCGCTTCTCCGTGAAGCCGGGCTCCGTCGAGGCGGCGGAGATGGCGCAGACGCTGCGCGACTGCGAGGCGCCGCCGGCGCAGGGCGAGAGGAAGGCGTGCGCCACGTCGCTCGAGTCCATGGTCGACTTCGCCACGTCGAGCCTCGGG---ACCAGCCACGTGAGGGCCGCGTCGACCGTGGTCGGGAAGGAAGGGTCGCCGGAGCAGGAGTACACCGTG------ACGGCGGTGAAGCGCGCGGCGGCCGGCGGCGACcagGACCAGCTCGTCGCCTGCCACGCGGAGCCGTACGCGTACGCCGTGTTCGCGTGCCACCTGACGCGGGCG...ACGCGGGCGTACGCGGTGTCGATGGCCGGCAGGGACGGCACG------GGCGTGGAGGCCGTCGCGGTGTGCCACGCCGACACGGCCGGGTGGAACCCGAAGCACGTCGCGTTCCAGGTGCTCAAGGTGAAGCCAGGCACGGTGCCGGTCTGCCACTTCCTGCCGCAGGACCACGTCGTCTGGACACGCAGC
TRN  10010101100011011
NAM  RD22_ARATH/174-392
ASQ  ALFFLEKDLVRGKEMNVRFNAeDGYGGKTAFLPRGEAETVPFGSEKFSETLKRFSVEAGSEEAEMMKKTIEECEARKVSGEEKYCATSLESMVDFSVSKLG-KYHVRAVSTEVAKKNAPMQKYKIAAAGVKKLSD---.DKSVVCHKQKYPFAVFYCHKAMM.TTVYAVPLEGENGM--RAKAVAVCHKNTSAWNPNHLAFKVLKVKPGTVPVCHFLPETHVVWFSY
DSQ  GCTCTCTTCTTCTTGGAGAAGGACTTGGTTCGCGGGAAAGAAATGAATGTCCGGTTTAACGCTgagGATGGTTACGGAGGCAAAACTGCGTTCTTGCCACGTGGAGAGGCTGAAACGGTGCCTTTTGGATCGGAGAAGTTTTCGGAGACGTTGAAACGTTTCTCGGTGGAAGCTGGTTCGGAAGAAGCGGAGATGATGAAGAAGACCATTGAGGAGTGTGAAGCCAGAAAAGTTAGTGGAGAGGAGAAGTATTGTGCGACGTCTTTGGAGTCGATGGTCGACTTTAGTGTTTCGAAACTTGGT---AAATATCACGTCAGGGCTGTTTCCACTGAGGTGGCTAAGAAGAACGCACCGATGCAGAAGTACAAAATCGCGGCGGCTGGGGTAAAGAAGTTGTCTGAC---------...GATAAATCTGTGGTGTGTCACAAACAGAAGTACCCATTCGCGGTGTTCTACTGCCACAAGGCGATGATG...ACGACCGTCTACGCGGTTCCGCTCGAGGGAGAGAACGGGATG------CGAGCTAAAGCAGTTGCGGTATGCCACAAGAACACCTCAGCTTGGAACCCAAACCACTTGGCCTTCAAAGTCTTAAAGGTGAAGCCAGGGACCGTTCCGGTCTGCCACTTCCTCCCGGAGACTCATGTTGTGTGGTTCAGCTAC
TRN  10010101110011000
NAM  Q947D4_PRUPE/134-346
ASQ  AIFFLEKDIRPGTSMTLTFS-.-GNSNTAAFVPRKTADSIPFSSNKLPEIFSQFSVKPESVEADIIKGTIEECESSGIRGEEKYCATSLESMVDFSTSKLG--GNIQAISTEA-EKGATLQKYTI-TPGVKKLAA---.GKSVVCHKQTYPYAVFYCHATKT.TRAYVVPLKGADGL--EAKAVAVCHTDTSEWNPKHLAFQVLKVKPGTVPVCHFLPKDHIVWVPK
DSQ  GCTATTTTCTTCTTGGAGAAGGACATACGTCCTGGCACAAGCATGACCTTGACGTTCTCT---...---GGAAACTCAAACACCGCGGCTTTCGTGCCACGCAAAACAGCGGATTCCATCCCCTTCTCGTCCAACAAGCTGCCAGAGATTTTCAGCCAGTTTTCGGTGAAGCCGGAGTCTGTGGAAGCTGATATAATCAAGGGGACAATTGAAGAGTGTGAGAGCTCAGGCATCAGAGGAGAGGAGAAGTATTGTGCTACCTCTTTGGAGTCAATGGTTGACTTCAGCACTTCCAAGCTTGGA------GGAAACATTCAAGCAATCTCAACAGAGGCA---GAGAAAGGAGCCACGTTGCAGAAGTACACTATT---ACCCCTGGAGTGAAGAAGCTGGCAGCT---------...GGTAAATCAGTTGTGTGCCACAAGCAGACCTATCCTTACGCTGTTTTCTACTGCCATGCAACAAAAACA...ACAAGAGCTTATGTGGTGCCTCTGAAGGGTGCTGATGGGTTG------GAGGCTAAAGCAGTAGCAGTTTGCCACACAGACACATCAGAGTGGAACCCAAAGCATTTGGCCTTCCAAGTGCTAAAAGTTAAGCCAGGAACCGTTCCCGTCTGCCATTTCCTTCCGAAAGATCACATTGTCTGGGTTCCAAAG
TRN  10010101100011001
NAM  Q94IC6_9ROSI/82-292
ASQ  TIFFLEKDLKPGKSMNLYFF-.-ESSNTATFLPRHVADSMPFSSNKLQEAFREFSVKPGSLEAETMEDTIKECENPRIEGEEKYCVTSLESIVDFSSSKLG--KDIQAISTEV-EKQTGRQKYTI--AVVKKMAG---.DKSVVCHKQNYPYAVFYCHTTQ-.SRAYLVQLKGADRS--ELKAVATCHTNTSAWNPKHMAFQVLAVKPGTVPVCHFLTQSHVVWAPK
DSQ  ACTATTTTTTTCTTGGAAAAAGACTTGAAACCGGGCAAATCCATGAACTTGTATTTCTTC---...---GAAAGCTCAAACACGGCAACTTTCTTGCCTCGCCACGTCGCAGATTCCATGCCATTTTCATCAAACAAGTTGCAAGAAGCTTTCCGCGAATTTTCGGTGAAGCCCGGATCTCTGGAAGCTGAAACAATGGAGGATACAATCAAGGAATGTGAAAATCCTAGAATTGAAGGAGAAGAGAAATACTGTGTAACTTCACTGGAGTCGATAGTTGACTTTAGCTCTTCCAAACTTGGA------AAGGACATTCAGGCAATCTCTACAGAGGTT---GAGAAGCAAACGGGCAGGCAGAAATATACAATC------GCCGTAGTAAAGAAGATGGCAGGT---------...GACAAATCCGTGGTTTGCCACAAGCAGAATTACCCTTATGCTGTATTCTACTGCCATACAACCCAA---...TCAAGGGCTTACCTGGTTCAATTAAAGGGTGCCGACAGATCA------GAGCTTAAAGCAGTAGCAACCTGCCACACGAACACATCAGCATGGAATCCAAAACATATGGCTTTCCAAGTGCTAGCGGTCAAACCCGGAACGGTGCCTGTTTGCCATTTCCTTACCCAGAGCCATGTTGTTTGGGCTCCCAAG
TRN  10010101100011000
NAM  Q8VWQ1_GOSHI/123-335
ASQ  ALFFLEKDMHPGATMSLHFT-.-ENTEKSAFLPYQTAQKIPFSSDKLPEIFNKFSVKPGSLKAEMMKNTIKECEQPAIEGEEKYCATSLESMIDYSISKLG--KVDQAVSTEV-EKQTPMQKYTI-AAGVQKMTD---.DKAVVCHKQNYAYAVFYCHKSET.TRAYMVPLEGADGT--KAKAVAVCHTDTSAWNPKHLAFQVLKVEPGTIPVCHFLPRDHIVWVPK
DSQ  GCTCTTTTCTTTCTGGAAAAGGATATGCACCCCGGGGCAACAATGAGCCTGCATTTCACT---...---GAAAATACAGAGAAATCAGCTTTCTTACCTTATCAAACTGCCCAAAAAATACCGTTTTCATCTGACAAGTTGCCAGAAATTTTCAACAAGTTTTCAGTGAAACCTGGATCACTGAAGGCAGAGATGATGAAGAACACAATTAAGGAGTGCGAACAGCCAGCGATTGAAGGAGAGGAAAAATATTGTGCAACCTCACTGGAGTCAATGATTGACTATAGCATTTCCAAACTAGGG------AAAGTTGATCAGGCAGTCTCAACAGAAGTG---GAAAAACAAACCCCAATGCAAAAGTATACAATA---GCAGCTGGAGTGCAGAAGATGACAGAT---------...GACAAAGCTGTAGTGTGCCACAAGCAGAATTATGCATATGCTGTCTTCTATTGCCATAAATCAGAAACA...ACAAGGGCTTACATGGTTCCTTTAGAGGGTGCTGACGGAACA------AAAGCCAAAGCAGTAGCAGTCTGCCACACAGATACATCAGCATGGAACCCTAAGCATTTGGCTTTTCAAGTCCTAAAAGTTGAACCAGGAACCATTCCTGTCTGCCATTTCCTTCCTCGGGATCACATTGTTTGGGTCCCTAAG
TRN  10010101100011000
NAM  Q8RUD9_SOYBN/91-305
ASQ  RLFFLEEDLRAGKIFNMKFV-.NNTKATVPLLPRQISKQIPFSEDKKKQVLAMLGVEANSSNAKIIAETIGLCQEPATEGERKHCATSLESMVDFVVSALG-K-NVGAFSTEK-ERETESGKFVVVKNGVRKLGD---.DKVIACHPMSYPYVVFGCHLVPR.SSGYLVRLKGEDGV--RVKAVVACHRDTSKWDHNHGAFKVLNLKPGNGTVCHVFTEGNLLWLPN
DSQ  AGGTTGTTTTTCTTGGAAGAGGACCTGCGTGCTGGCAAAATATTCAACATGAAGTTCGTC---...AACAACACAAAAGCCACAGTCCCGTTGCTACCGCGCCAAATTTCGAAACAAATACCGTTCTCAGAAGATAAAAAGAAGCAAGTGTTGGCGATGCTTGGCGTGGAAGCGAACTCAAGCAACGCCAAGATCATAGCGGAGACCATTGGTCTTTGCCAAGAGCCTGCAACGGAGGGAGAAAGGAAACACTGCGCGACTTCGTTGGAGTCCATGGTTGATTTCGTCGTTTCCGCGCTCGGG---AAG---AACGTTGGTGCTTTCTCAACAGAGAAA---GAAAGGGAAACTGAGTCTGGAAAGTTTGTAGTGGTGAAAAATGGGGTGAGGAAGTTGGGAGAT---------...GATAAGGTTATTGCCTGTCATCCAATGAGTTACCCTTATGTTGTGTTTGGGTGTCATCTAGTGCCAAGG...AGTAGCGGGTATTTGGTGCGCTTGAAGGGAGAAGATGGGGTT------CGAGTGAAAGCAGTTGTTGCGTGCCACAGAGACACGTCAAAGTGGGACCATAATCATGGGGCATTCAAAGTGCTCAATCTTAAGCCTGGGAATGGTACAGTATGCCATGTCTTCACTGAGGGGAATCTTCTTTGGCTTCCAAAT
TRN  10010101100011001
NAM  Q8GSG3_9FABA/190-402
ASQ  SNFFSEERLRRGAKLDVLFR-.-KRNFSTPLLTREIAEHLPFSSEKINEILEILAVKPDSKDAKNVEETLNHCEKPALKGEEKQCATSVESMVDFVTSKLGNNARVTSTELEI---GSKFQKFIV-KDGVKILAE---.EKIIACHPMSYPYVVFYCHKMAN.STAHFLPLEGEDGT--RVKAVAICHKDTSQWDPHHVAFQVLKVKPGTSSACHFFPEGHLVWYAK
DSQ  AGTAATTTTTTCTCAGAAGAAAGATTGAGGCGCGGTGCAAAATTGGATGTGCTGTTCCGT---...---AAAAGAAATTTTTCAACCCCGTTGTTGACCCGCGAAATTGCAGAACACTTACCATTCTCATCAGAAAAGATAAATGAAATATTAGAGATTTTGGCTGTGAAGCCAGATTCTAAGGATGCTAAGAATGTGGAGGAAACTCTGAATCACTGTGAAAAGCCTGCATTGAAGGGTGAAGAAAAACAGTGTGCAACTTCAGTAGAATCCATGGTAGACTTTGTCACTTCTAAACTTGGCAATAACGCCCGTGTTACTTCTACAGAGCTAGAAATT---------GGAAGCAAGTTCCAAAAGTTCATAGTT---AAAGATGGAGTGAAGATTTTAGCAGAA---------...GAAAAGATAATTGCATGTCACCCAATGAGTTACCCATATGTTGTGTTTTACTGCCATAAGATGGCGAAT...AGCACTGCACATTTTTTACCATTGGAGGGAGAAGATGGAACT------AGGGTTAAAGCTGTAGCAATCTGCCACAAAGACACATCACAATGGGATCCACACCATGTTGCATTCCAAGTTCTCAAAGTGAAGCCTGGGACCAGTTCTGCGTGTCATTTCTTCCCTGAGGGTCATCTTGTTTGGTATGCTAAA
TRN  10010101100011000
NAM  O65009_BRANA/58-282
ASQ  YMFFKISDLKLGTKLPIYFNK.NDLRKVPPLLTRQEADLIPFSESNLDFLLNHFSISKDSPQGKAMKETLKRCDFKAIEGEYKFCGTSLESMLDLAKKTIASNADLKVMTTKVMVPDQNRISYALHNYTFAEVPKELDgIKVLGCHRMPYPYVVYYCHGHKSgTKVFEVNLMSDDGIQ-LVVGPAVCHMDTSMWNADHVAFKVLKIEPRSAPVCHFFPLDNIVWVSK
DSQ  TACATGTTTTTCAAAATCAGTGATCTTAAATTAGGAACCAAGTTGCCCATTTACTTCAACAAA...AACGATCTTCGAAAAGTTCCTCCACTTCTCACAAGACAAGAAGCTGATCTCATCCCTTTCAGTGAGTCTAACCTTGACTTCCTTCTCAACCACTTCTCTATCTCCAAAGACTCTCCTCAAGGGAAAGCCATGAAGGAGACTTTGAAACGTTGTGATTTCAAAGCTATTGAAGGAGAGTATAAGTTTTGTGGTACTTCTTTGGAGTCAATGCTTGATCTTGCCAAGAAAACAATAGCGTCTAATGCTGATCTCAAGGTCATGACGACCAAAGTAATGGTGCCGGACCAAAATAGAATAAGCTATGCTTTGCATAACTATACATTCGCGGAGGTACCAAAGGAGCTAGATgggATTAAGGTCTTGGGGTGTCATAGAATGCCATACCCTTATGTAGTTTACTATTGCCATGGTCATAAAAGTggaACCAAAGTCTTTGAGGTTAATCTGATGAGTGACGATGGGATACAA---CTAGTTGTGGGACCTGCGGTTTGCCACATGGATACGTCGATGTGGAACGCTGATCATGTGGCTTTTAAGGTGTTGAAGATAGAGCCGAGGTCCGCACCGGTTTGTCACTTCTTCCCTCTTGATAATATTGTGTGGGTATCAAAG
TRN  10010101100011000
NAM  Q06765_SOYBN/70-259
ASQ  KTFFYKEDLHPGKTMKVQFSKpPFQQPWGVGTWLKEIKD----TTKEGYSFEELCIKKE-----------------AIEGEEKFCAKSLGTVIGFAISKLG--KNIQVLSSSF---VNKQDQYTV--EGVQNLG----.DKAVMCHRLNFRTAVFYCHEVRE.TTAFMVPLVAGDGT--KTQALAICHSNTSGMNH-QMLHQLMGVDPGTNPVCHFLGSKAILWVPN
DSQ  AAAACCTTCTTCTATAAAGAAGACCTTCATCCAGGCAAAACAATGAAAGTACAATTCAGCAAGcctCCCTTTCAACAACCATGGGGTGTTGGTACATGGTTAAAGGAAATTAAAGAC------------ACTACTAAAGAAGGATATAGTTTTGAAGAGCTATGCATCAAGAAAGAA---------------------------------------------------GCCATTGAGGGAGAAGAGAAGTTTTGTGCAAAATCCTTGGGAACAGTAATTGGTTTTGCCATTTCAAAGCTGGGA------AAGAACATTCAAGTACTTTCAAGTTCCTTT---------GTCAATAAGCAAGACCAATACACTGTG------GAAGGAGTGCAGAATCTTGGA------------...GACAAAGCAGTGATGTGTCATAGGCTAAATTTCAGAACTGCAGTATTTTACTGCCATGAAGTCCGTGAA...ACAACAGCTTTCATGGTTCCATTGGTGGCTGGTGATGGAACC------AAAACTCAGGCACTTGCTATTTGCCACTCAAATACTTCTGGAATGAATCAT---CAAATGCTTCATCAACTTATGGGAGTTGATCCTGGAACTAACCCTGTTTGCCATTTCCTTGGAAGCAAGGCCATTTTATGGGTACCCAAT
TRN  10010101100011000
NAM  SVF30_VICFA/66-259
ASQ  STLFFEHDLHPRKNFILGNTNsVGSIIRPFTKSRQGVTDSIWLANKEKQSLEDF------------------CYSPTAIAEHKHCVSSLKSMIDQVISHFG-STKIKAISSNF---APYQDQYVV--EDVKKVG----.DNAVMCHRLNFEKVVFNCHQVRD.TTAYVVSLVASDGT--KTKALTVCHHDTRGMNP-ELLYEALEVTLGTVPVCHFIGNKAAAWVPN
DSQ  TCAACGCTGTTTTTTGAACATGACCTTCACCCTAGGAAAAATTTCATCTTGGGCAACACTAATtctGTAGGAAGTATAATTCGACCATTCACAAAATCAAGACAAGGGGTCACAGATTCCATATGGCTGGCAAATAAAGAGAAACAAAGTCTTGAGGATTTT------------------------------------------------------TGTTATAGTCCAACTGCTATAGCAGAACACAAACATTGCGTATCATCCTTGAAATCGATGATTGACCAAGTCATTTCACATTTTGGA---AGTACAAAGATTAAGGCAATTTCAAGTAACTTT---------GCTCCATATCAAGACCAATATGTAGTG------GAAGATGTGAAAAAGGTTGGA------------...GATAATGCAGTGATGTGTCATAGATTGAATTTTGAAAAGGTAGTATTCAATTGCCACCAAGTGCGTGAT...ACAACCGCTTATGTGGTCTCATTGGTAGCCTCAGATGGAACT------AAAACTAAGGCTTTAACAGTCTGCCACCATGACACTAGAGGTATGAATCCT---GAGTTGCTTTATGAAGCACTCGAAGTTACTCTTGGAACTGTCCCTGTATGTCATTTCATTGGCAATAAAGCCGCTGCTTGGGTACCAAAT
TRN  10010101100011000
NAM  Q93X11_9POAL/86-301
ASQ  MLFFNEHDVLEGKTFPMYFP-.PSVTAKLGFLQRRVVQEIPFTSARLADILALFHIPPGSSEAADVATTLGLCD-AAAHGDVVRCVTSPDDMVGRAAAVLG-TSNMQVLAPSIPTGGMSLQPYTV--RAVKPVDG---.SDFVGCHPELYPYSVYRCHTSVQ.TGTYVMEMQSSYGNGGALKLVAVCHRNTTSWDPEHVSFKVLASKPGGLPICHFVPYGHVIFGKR
NAM  P93217_LYCES/412-628
ASQ  GKFFREKMLKSGTIMPMPDI-.KDKMPKRSFLPRAIAAKLPFSTSKIDELKKIFHAANDSQVAKMIGDALSECERAPSPGETKQCVNSAEDMIDFATSVLGRNVVVRTTENTN----GSKGNIMI--GSIKGINGGKV.TKSVSCHQTLYPSLLYYCHSVPK.VRVYEADILDPNSKAKINHGVAICHVDTSSWGPRHGAFIALGSGPGKIEVCHWIFENDMTWATA
DSQ  GGGAAGTTTTTCCGTGAGAAGATGTTGAAGAGTGGTACAATCATGCCTATGCCAGATATA---...AAGGATAAGATGCCTAAAAGGTCCTTTTTGCCCCGGGCGATTGCTGCGAAATTGCCTTTTTCTACGTCAAAGATTGATGAGCTGAAGAAAATTTTCCATGCGGCCAATGATTCACAGGTGGCAAAGATGATTGGCGATGCGCTGAGTGAGTGTGAAAGAGCACCGAGCCCTGGGGAGACGAAACAATGTGTTAATTCAGCTGAAGATATGATTGATTTCGCAACATCAGTGTTGGGTCGTAATGTGGTGGTTCGAACAACTGAGAATACAAAT------------GGATCAAAGGGGAACATCATGATT------GGATCAATAAAAGGAATCAATGGTGGAAAAGTT...ACCAAATCAGTATCATGTCATCAAACGCTGTACCCTTCCTTATTGTATTACTGTCATTCGGTTCCTAAA...GTCCGAGTCTACGAAGCGGATATTTTGGACCCGAATTCAAAGGCTAAGATCAACCATGGTGTTGCGATTTGCCACGTGGATACTTCTTCATGGGGACCGAGGCACGGAGCCTTCATTGCACTCGGGTCAGGACCCGGGAAAATAGAGGTTTGTCACTGGATCTTTGAGAATGACATGACTTGGGCAACTGCA
TRN  10010101100011000
NAM  O80760_ARATH/407-623
ASQ  GKFFREAMLKEGTLMQMPDI-.KDKMPKRTFLPRNIVKNLPFSSSTIGEIWRVFGAGENSSMAGIISSAVSECERPASHGETKRCVGSAEDMIDFATSVLGRGVVVRTTENVV----GSKKKVVI--GKVNGINGGDV.TRAVSCHQSLYPYLLYYCHSVPR.VRVYETDLLDPKSLEKINHGVAICHIDTSAWSPSHGAFLALGSGPGQIEVCHWIFENDMTWNII
DSQ  GGTAAATTCTTCAGAGAAGCGATGTTGAAAGAAGGGACTTTGATGCAAATGCCGGATATT---...AAAGATAAAATGCCTAAAAGGACATTTTTACCCCGAAACATAGTTAAGAATTTACCGTTTTCGTCATCTACGATCGGAGAGATTTGGAGGGTTTTTGGTGCCGGTGAGAATTCATCAATGGCGGGGATAATCTCGTCGGCGGTTTCAGAGTGTGAGAGACCGGCGAGTCACGGTGAGACAAAGCGGTGTGTTGGATCAGCGGAGGATATGATAGATTTCGCTACGTCGGTGCTCGGACGCGGCGTAGTGGTGAGGACGACGGAAAATGTTGTC------------GGGTCAAAGAAGAAGGTCGTCATT------GGAAAAGTCAATGGAATCAACGGTGGAGATGTA...ACAAGAGCAGTTTCGTGTCACCAGAGTTTGTACCCGTATTTACTGTATTATTGTCACTCGGTTCCTCGG...GTACGTGTTTATGAAACGGATCTACTTGACCCGAAGAGTTTAGAGAAGATTAACCATGGTGTTGCCATCTGTCACATTGATACGTCAGCTTGGAGTCCGAGTCATGGAGCGTTTTTGGCTTTAGGTTCTGGTCCGGGTCAGATTGAAGTTTGCCATTGGATCTTTGAGAATGATATGACGTGGAATATTATT
TRN  10010101100011000
NAM  O64599_ARATH/409-625
ASQ  GKFFRESSLKEGTVIPMPDI-.KDKMPKRSFLPRSIITKLPFSTSKLGEIKRIFHAVENSTMGGIITDAVTECERPPSVGETKRCVGSAEDMIDFATSVLGRSVVLRTTENVA----GSKEKVVI--GKVNGINGGKL.TKAVSCHQSLYPYLLYYCHSVPK.VRVYEADLLELNSKKKINHGIAICHMDTSSWGPSHGAFLALGSKPGRIEVCHWIFENDMNWAIA
DSQ  GGTAAATTCTTTAGAGAATCGTCGCTTAAAGAAGGTACAGTGATTCCTATGCCTGATATT---...AAAGATAAAATGCCTAAAAGGTCGTTTTTACCCCGGAGTATAATTACGAAACTACCCTTCTCTACTTCTAAACTCGGTGAGATTAAGAGAATCTTCCACGCCGTTGAGAATTCGACGATGGGAGGTATAATCACCGACGCAGTGACGGAGTGCGAGAGGCCACCGAGCGTCGGAGAGACGAAACGGTGCGTAGGATCAGCGGAGGATATGATCGATTTCGCGACGTCGGTGTTAGGTCGTAGCGTGGTGCTTAGAACAACGGAGAACGTAGCC------------GGGTCAAAGGAAAAGGTAGTGATC------GGGAAAGTCAACGGAATCAACGGTGGGAAATTA...ACGAAAGCTGTGTCGTGTCATCAGAGTTTGTACCCGTATCTATTGTATTACTGCCACTCCGTACCAAAG...GTTCGGGTATACGAAGCTGATCTTCTAGAGTTGAATAGTAAGAAGAAGATTAACCACGGGATTGCCATCTGTCACATGGACACGTCATCATGGGGTCCGAGTCATGGAGCTTTCTTAGCTCTCGGGTCAAAACCGGGTCGGATCGAAGTTTGTCACTGGATATTTGAGAACGACATGAACTGGGCTATCGCT
TRN  10010101110011000
//