EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03174 - CHB_HEX_C)
FAM  PF03174
PID  CHB_HEX_C
DES  Chitobiase/beta-hexosaminidase C-terminal domain
IPR  IPR004867
ANO  5
ALN  67
AID  0.400885
APH  (((CHB_VIBHA/817-882:0.44360,HEX_VIBVU/780-844:0.55203):0.08483,CHB_SERMA/819-885:0.39404):0.39879,Q9R6Y9_ALTSO/848-913:0.31830,Q9ZH38_9GAMM/795-859:0.96267);
ATP  (((CHB_VIBHA/817-882,HEX_VIBVU/780-844),CHB_SERMA/819-885),Q9R6Y9_ALTSO/848-913,Q9ZH38_9GAMM/795-859);
ATL  3.15426
DNO  5
DLN  201
DID  0.44839
DPH  ((CHB_SERMA/819-885:0.39558,(Q9R6Y9_ALTSO/848-913:0.30677,Q9ZH38_9GAMM/795-859:0.79807):0.26150):0.07260,CHB_VIBHA/817-882:0.36528,HEX_VIBVU/780-844:0.47747);
DTP  ((CHB_SERMA/819-885,(Q9R6Y9_ALTSO/848-913,Q9ZH38_9GAMM/795-859)),CHB_VIBHA/817-882,HEX_VIBVU/780-844);
DTL  2.67727
RID  0.400885
RPH  (((CHB_VIBHA/817-882:0.44360,HEX_VIBVU/780-844:0.55203):0.08483,CHB_SERMA/819-885:0.39404):0.39879,Q9R6Y9_ALTSO/848-913:0.31830,Q9ZH38_9GAMM/795-859:0.96267);
RTP  (((CHB_VIBHA/817-882,HEX_VIBVU/780-844),CHB_SERMA/819-885),Q9R6Y9_ALTSO/848-913,Q9ZH38_9GAMM/795-859);
RTL  3.15426
LNK  CHB_SERMA/819-885:Q54468:L43594
LNK  CHB_VIBHA/817-882:P13670:J05004
LNK  HEX_VIBVU/780-844:Q04786:L04544
LNK  Q9R6Y9_ALTSO/848-913:Q9R6Y9:AB026053
LNK  Q9ZH38_9GAMM/795-859:Q9ZH38:AF072375
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9ZH38_9GAMM/795-859
ASQ  LDVPGGEVNKGTLTTSVATAYLDVEYSVDQGKSWQTYQQPVN-VGDTQVWLRSSLNDQ-VKSRITTI
DSQ  CTTGATGTACCGGGCGGTGAAGTCAATAAGGGTACTCTAACTACCAGTGTTGCAACAGCTTACTTAGATGTTGAATACAGTGTTGACCAAGGTAAATCATGGCAAACATACCAGCAACCAGTTAAC---GTAGGTGATACACAAGTGTGGTTAAGAAGTTCATTAAATGACCAA---GTTAAGAGTCGTATAACCACAATT
TRN  10010101110011000
NAM  CHB_VIBHA/817-882
ASQ  LPVPGAKVEDGKLAMNVQFPGVTLQYSLDG-ENWLTYADNARPNVTGEVFIRSVSATGEKVSRITSV
DSQ  CTACCAGTACCAGGTGCAAAAGTAGAAGATGGTAAGCTAGCAATGAACGTTCAGTTCCCTGGCGTAACGCTTCAATACTCTCTGGATGGT---GAGAACTGGTTGACTTATGCAGACAACGCTCGTCCAAATGTAACTGGTGAAGTCTTCATCCGCTCGGTATCTGCGACAGGTGAGAAGGTAAGCCGTATCACTAGCGTG
TRN  11011101101011011
NAM  CHB_SERMA/819-885
ASQ  LPVPGARVAAGKLEANIALPGLGIEYSTDGGKQWQRYDAKAKPAVSGEVQVRSVSPDGKRYSRAEKV
DSQ  CTGCCGGTGCCGGGTGCCCGCGTGGCGGCTGGCAAGCTGGAAGCGAATATCGCGCTGCCGGGATTGGGCATCGAGTATTCCACCGACGGCGGCAAGCAGTGGCAGCGCTATGACGCCAAGGCCAAGCCGGCGGTCTCCGGTGAAGTGCAGGTGCGTTCGGTCAGCCCGGACGGTAAACGCTACAGCCGCGCCGAGAAGGTC
TRN  11011101101011011
NAM  HEX_VIBVU/780-844
ASQ  LPVLGAVIKNNILDVVTEFHGVAIQYSLDG-KTWHKYDDTKKPQVSTKALVRSVSTNG-RTGRAVEV
DSQ  CTGCCAGTTCTTGGTGCTGTTATCAAAAACAATATCCTTGATGTTGTGACAGAGTTCCACGGTGTTGCCATCCAATATTCATTGGATGGC---AAAACGTGGCATAAGTACGACGATACTAAGAAGCCCCAAGTGAGTACTAAGGCGCTCGTTCGTTCAGTATCGACAAACGGT---CGTACAGGTCGTGCGGTTGAAGTT
TRN  11011101101011001
NAM  Q9R6Y9_ALTSO/848-913
ASQ  IPLPGGAIEGGKLIVNTRFVGMATEYSVDQGVTWHRYEGPVTLTASSKVQLRTVSDSG-KVSRVATV
DSQ  ATTCCATTACCTGGAGGCGCGATTGAAGGTGGTAAGTTAATCGTCAATACCCGGTTTGTTGGCATGGCTACGGAGTATTCGGTTGACCAAGGCGTAACATGGCATCGCTATGAAGGGCCTGTGACATTGACCGCGTCATCTAAAGTACAACTCAGAACGGTGAGTGATTCGGGC---AAAGTAAGCCGAGTCGCGACGGTT
TRN  10010101110011000
//