EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03168 - LEA_2)
FAM  PF03168
PID  LEA_2
DES  Late embryogenesis abundant protein
IPR  IPR004864
ANO  9
ALN  156
AID  0.556317
APH  ((Q9ZQW6_PSEMZ/2-151:0.56219,(LE14_GOSHI/2-151:0.10315,(O82355_ARATH/17-166:0.32008,O03983_ARATH/2-151:0.22287):0.06187):0.00000):0.07311,LE14_SOYBN/2-151:0.08170,((O80576_ARATH/40-195:1.33914,(Q9SPJ4_CAPAN/2-151:0.15536,Q40159_LYCES/1-150:0.19182):0.01136):0.08518,DRPD_CRAPL/2-151:0.26040):0.08284);
ATP  ((Q9ZQW6_PSEMZ/2-151,(LE14_GOSHI/2-151,(O82355_ARATH/17-166,O03983_ARATH/2-151))),LE14_SOYBN/2-151,((O80576_ARATH/40-195,(Q9SPJ4_CAPAN/2-151,Q40159_LYCES/1-150)),DRPD_CRAPL/2-151));
ATL  3.55107
DNO  9
DLN  468
DID  0.597222
DPH  ((Q9ZQW6_PSEMZ/2-151:0.42278,(O82355_ARATH/17-166:0.22921,O03983_ARATH/2-151:0.22551):0.04560):0.07033,(((O80576_ARATH/40-195:0.78160,(Q9SPJ4_CAPAN/2-151:0.11914,Q40159_LYCES/1-150:0.15555):0.06115):0.07910,DRPD_CRAPL/2-151:0.32864):0.05957,LE14_SOYBN/2-151:0.11160):0.06508,LE14_GOSHI/2-151:0.09497);
DTP  ((Q9ZQW6_PSEMZ/2-151,(O82355_ARATH/17-166,O03983_ARATH/2-151)),(((O80576_ARATH/40-195,(Q9SPJ4_CAPAN/2-151,Q40159_LYCES/1-150)),DRPD_CRAPL/2-151),LE14_SOYBN/2-151),LE14_GOSHI/2-151);
DTL  2.84983
RID  0.556317
RPH  ((Q9ZQW6_PSEMZ/2-151:0.56219,(LE14_GOSHI/2-151:0.10315,(O82355_ARATH/17-166:0.32008,O03983_ARATH/2-151:0.22287):0.06187):0.00000):0.07311,LE14_SOYBN/2-151:0.08170,((O80576_ARATH/40-195:1.33914,(Q9SPJ4_CAPAN/2-151:0.15536,Q40159_LYCES/1-150:0.19182):0.01136):0.08518,DRPD_CRAPL/2-151:0.26040):0.08284);
RTP  ((Q9ZQW6_PSEMZ/2-151,(LE14_GOSHI/2-151,(O82355_ARATH/17-166,O03983_ARATH/2-151))),LE14_SOYBN/2-151,((O80576_ARATH/40-195,(Q9SPJ4_CAPAN/2-151,Q40159_LYCES/1-150)),DRPD_CRAPL/2-151));
RTL  3.55107
LNK  DRPD_CRAPL/2-151:P22241:M62990
LNK  LE14_GOSHI/2-151:P46518:M88322
LNK  LE14_SOYBN/2-151:P46519:U08108
LNK  O03983_ARATH/2-151:O03983:Y10085
LNK  O80576_ARATH/40-195:O80576:AC004005
LNK  O82355_ARATH/17-166:O82355:AC005397
LNK  Q40159_LYCES/1-150:Q40159:Z46654
LNK  Q9SPJ4_CAPAN/2-151:Q9SPJ4:AF168168
LNK  Q9ZQW6_PSEMZ/2-151:Q9ZQW6:AJ012483
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  O03983_ARATH/2-151
ASQ  ASLLDKAKDFVADKLTAIP------KPEGSVTDVDLKDVNRDSVEYLAKVSVTNPYSHSIPICEISFTFHSAGREIGKGKIPDPGSLKAKDMTALDIPVVVPYSILFNLARDVGVDWDIDYELQIGLTIDLPVVGEFTIPISSKGEIKLPTFKDFF
DSQ  GCGAGCTTGCTAGATAAAGCCAAGGACTTCGTGGCGGATAAACTCACCGCGATCCCT------------------AAACCGGAGGGTTCAGTTACGGACGTTGACCTCAAAGACGTGAACCGTGACTCAGTTGAGTACTTGGCCAAAGTCTCTGTCACCAATCCTTACAGTCATTCGATTCCGATCTGTGAGATCAGTTTCACTTTCCACAGCGCCGGCAGGGAGATTGGAAAGGGGAAGATACCGGACCCGGGTTCTCTGAAAGCTAAGGACATGACGGCTCTTGATATTCCCGTGGTGGTGCCGTATAGTATACTGTTTAACCTGGCTCGAGACGTTGGTGTGGACTGGGACATTGACTACGAGCTCCAAATCGGTCTAACCATCGACCTTCCTGTTGTAGGGGAATTTACTATCCCTATCTCTAGTAAGGGAGAAATCAAACTTCCTACTTTTAAAGATTTCTTC
TRN  10010101100011001
NAM  LE14_SOYBN/2-151
ASQ  SQLLDKAKNYVAEKVTNMP------KPEASVTDVDFKRVSRDSVEYLAKVSVSNPYSTPIPICEIKYSLKSAGKEIASGTIPDPGSLKASDTTMLDVPVKVPHSILLSLAKDIGADWDIDYQLDLGLVIDLPVIGNFTIPLSQKGEIKLPTLSDMF
DSQ  TCGCAGTTGTTGGACAAAGCCAAAAACTATGTTGCGGAGAAAGTCACGAACATGCCC------------------AAGCCCGAGGCGAGTGTCACCGACGTGGATTTCAAGCGCGTGAGCCGCGACAGCGTCGAGTACTTGGCTAAGGTCTCTGTTTCCAACCCTTATTCCACTCCCATTCCCATTTGTGAGATCAAGTACTCCCTCAAAAGTGCTGGCAAGGAGATAGCATCAGGGACAATACCTGACCCAGGGTCACTGAAGGCAAGTGACACAACAATGCTGGATGTGCCAGTGAAGGTGCCTCATAGCATATTACTGAGCTTGGCAAAGGACATTGGTGCAGATTGGGACATTGATTACCAATTGGATCTTGGTCTAGTTATTGACCTTCCTGTCATTGGCAACTTCACCATTCCTCTTTCTCAGAAGGGAGAGATAAAGCTCCCAACCCTCTCTGACATGTTT
TRN  10010101100011000
NAM  LE14_GOSHI/2-151
ASQ  SQLLEKAKDFVVDKVANIK------KPEASVSDVDLKHVSRECVEYGAKVSVSNPYSHSIPICEISYNFRSAGRGIASGTIPDPGSLKASDTTMLDVPVKVPYNILVSLVKDIGADWDIDYELELGLTIDLPIVGNFTIPLSQKGEIKLPTLSDIF
DSQ  TCGCAGTTGTTGGAGAAGGCGAAGGACTTCGTGGTGGATAAGGTGGCCAACATAAAG------------------AAGCCGGAGGCTAGTGTCTCGGACGTTGATCTGAAACATGTGAGCCGTGAGTGCGTCGAGTATGGCGCTAAGGTCTCTGTCTCCAACCCCTACAGCCATTCCATCCCCATTTGTGAGATCTCTTACAATTTCAGAAGTGCTGGAAGAGGGATAGCATCAGGGACAATACCAGACCCGGGGTCATTGAAAGCCAGCGACACAACGATGCTGGACGTGCCAGTGAAGGTACCGTATAACATCTTAGTAAGCTTGGTAAAGGATATTGGTGCAGATTGGGACATTGACTATGAATTGGAATTGGGTCTCACCATTGATCTTCCTATCGTGGGGAACTTCACTATCCCTCTCTCTCAGAAAGGAGAGATCAAGCTTCCTACTCTCAGTGACATCTTT
TRN  10010101100011000
NAM  O82355_ARATH/17-166
ASQ  SSLLDKAKGFFAEKLANIP------TPEATVDDVDFKGVTRDGVDYHAKVSVKNPYSQSIPICQISYILKSATRTIASGTIPDPGSLVGSGTTVLDVPVKVAYSIAVSLMKDMCTDWDIDYQLDIGLTFDIPVVGDITIPVSTQGEIKLPSLRDFF
DSQ  TCAAGCTTGTTGGACAAAGCCAAAGGTTTCTTTGCGGAGAAGCTGGCGAATATTCCG------------------ACGCCGGAAGCAACCGTGGACGACGTTGATTTCAAAGGCGTGACACGTGATGGAGTAGATTATCACGCCAAGGTCTCCGTCAAGAATCCTTACTCTCAATCCATCCCTATCTGCCAGATCTCTTACATCCTCAAGAGTGCCACAAGGACGATCGCGTCAGGCACGATACCGGACCCGGGTTCGTTGGTTGGGAGCGGCACGACGGTTCTGGACGTACCGGTTAAGGTGGCTTATAGCATAGCGGTTAGTCTGATGAAGGATATGTGTACGGACTGGGACATTGACTATCAACTAGACATTGGGCTAACCTTCGACATTCCTGTTGTTGGTGATATCACCATTCCTGTCTCTACTCAGGGAGAGATCAAGCTCCCTTCCCTTCGCGACTTCTTT
TRN  10010101100011001
NAM  Q40159_LYCES/1-150
ASQ  MDLIDKAKNFVSEKIANME------KPEATITDVDLKGIGFDGLAFHAKVSVKNPYSVPIPIMEIDYVLKSATRVIASGRIPDPGSIKANDSTMLDVPVKVPHSVLVSLVRDIGGDWDVDYTLELGLIIDIPVIGNITIPLSYSGEYKLPTLSDLW
DSQ  ATGGATCTAATTGACAAGGCGAAGAATTTTGTGTCGGAGAAGATAGCCAACATGGAG------------------AAACCGGAGGCAACCATCACCGACGTCGATCTTAAGGGGATCGGTTTCGACGGCCTTGCTTTTCACGCTAAAGTCTCCGTTAAGAACCCTTACTCTGTTCCTATTCCAATCATGGAGATCGATTACGTCCTCAAAAGCGCCACCAGGGTAATCGCATCAGGAAGAATTCCAGACCCAGGGAGCATAAAGGCAAATGACTCAACCATGTTAGATGTGCCAGTGAAGGTTCCTCACAGTGTGCTAGTGAGTTTGGTTAGGGACATTGGAGGAGATTGGGACGTCGATTATACCCTGGAATTGGGTCTCATTATTGATATTCCGGTCATTGGCAACATCACCATTCCCCTCTCTTATAGCGGCGAGTATAAGCTTCCTACATTGTCAGATTTATGG
TRN  10010101100011000
NAM  Q9SPJ4_CAPAN/2-151
ASQ  ADLMEKAKNYVVEKVGNME------KPEAEITDVDMKKVSMDSISYHANVAVKNPYSVPVPIMQISYALKCSGRIIVSGTIPDPGNIKANDTTMLDVPVKVPHSVLVSLAKDIGKDWDIDYTLELGLTIDLPVIGNFTIPLSHSGEIKLPSISDLW
DSQ  GCAGATTTGATGGAGAAAGCGAAGAATTACGTGGTGGAGAAGGTGGGGAATATGGAG------------------AAACCAGAGGCAGAAATAACAGACGTTGATATGAAGAAAGTGAGCATGGACAGTATTTCTTATCATGCTAACGTCGCTGTCAAGAACCCTTACTCTGTTCCAGTACCCATCATGCAAATCTCTTACGCCCTCAAATGCTCTGGCAGGATAATAGTATCAGGAACAATTCCAGACCCGGGGAATATAAAGGCAAATGACACAACCATGTTAGATGTGCCAGTGAAAGTTCCTCACAGTGTGCTGGTGAGCTTGGCTAAGGATATTGGTAAAGATTGGGACATTGACTATACACTTGAATTGGGTCTCACCATTGACCTTCCTGTCATTGGAAATTTCACCATTCCACTCTCTCATAGTGGTGAGATCAAGCTTCCATCAATCTCTGACTTATGG
TRN  10010101100011000
NAM  DRPD_CRAPL/2-151
ASQ  AQLMNKAKNFVAEKVANVE------KPKASVEDVDLKDVGRHGITYLTRICVENPYSASIPVGEIKYTLKSAGRVIVSGNIPDPGSLKGNDKTMLEPAIKVPHSALVSLIKDIGADMDIDYVLELGLVVDLPVIGNFTIPLSHKGEMKLPGLSDIF
DSQ  GCTCAGCTGATGAACAAGGCCAAGAACTTCGTCGCAGAGAAGGTCGCCAACGTCGAA------------------AAGCCCAAGGCATCGGTGGAGGACGTCGACCTAAAGGACGTCGGCCGCCATGGAATCACATACTTAACCAGAATCTGCGTCGAAAACCCTTACAGCGCCTCCATCCCCGTCGGAGAAATCAAGTACACCCTCAAAAGCGCCGGCAGGGTTATTGTTTCTGGCAACATACCTGACCCAGGCTCGTTGAAGGGAAACGATAAGACTATGCTCGAGCCAGCCATTAAAGTGCCACACAGTGCTTTAGTGAGCTTGATAAAGGACATCGGCGCCGACATGGATATCGACTACGTGCTCGAGCTTGGGCTCGTCGTCGATTTGCCGGTGATCGGAAATTTCACGATTCCATTGTCTCACAAGGGGGAGATGAAGCTTCCCGGTTTGTCCGACATTTTC
TRN  10010101100011010
NAM  Q9ZQW6_PSEMZ/2-151
ASQ  ASLMDKAKQFVVDKIAHIE------KPSADVTDIDMKNLTTDSVTLESAIDITNPYDHDLPIWEISFRLRSADKLIASGTIKDPGSVKANDKTGMIVPVTVPYNFLISIMKDLGRDWDIDYEWDIGLTMHIPVVGKFTLPLNKKGTMKLPTLSDIF
DSQ  GCGAGTCTGATGGACAAAGCGAAACAGTTCGTAGTAGACAAAATCGCCCATATAGAA------------------AAACCGAGCGCAGATGTTACAGATATCGATATGAAAAATCTTACCACGGACTCAGTCACTCTGGAGAGCGCGATTGACATTACCAATCCTTACGATCATGACCTACCAATTTGGGAAATTTCATTTAGACTCCGAAGCGCAGACAAACTGATAGCGTCTGGAACAATTAAAGATCCTGGGTCAGTGAAGGCCAATGACAAGACAGGCATGATCGTTCCAGTGACAGTGCCGTACAACTTCTTGATCAGCATTATGAAAGACCTTGGCAGGGATTGGGATATTGACTATGAGTGGGATATTGGGCTTACCATGCACATTCCTGTTGTTGGGAAATTCACCCTTCCCCTCAACAAGAAGGGCACTATGAAGCTGCCCACTCTGTCAGATATTTTT
TRN  10010101100011001
NAM  O80576_ARATH/40-195
ASQ  GGFLDKVKDFIHDIGEKLEGTIGFGKPTADVSAIHIPKINLERADIVVDVLVKNPNPVPIPLIDVNYLVESDGRKLVSGLIPDAGTLKAHGEETVKIPLTLIYDDIKSTYNDINPGMIIPYRIKVDLIVDVPVLGRLTLPLEKCGEIPIPKKPDVD
DSQ  GGTGGATTCCTCGATAAGGTGAAAGATTTCATTCATGACATTGGTGAGAAACTCGAGGGAACCATTGGCTTTGGGAAGCCAACTGCTGATGTCTCTGCGATTCATATCCCTAAGATCAATCTTGAGAGGGCAGATATTGTTGTGGATGTGCTTGTCAAGAACCCGAATCCAGTTCCTATCCCTCTCATCGATGTCAACTACCTGGTCGAGAGCGATGGGAGGAAACTGGTTTCTGGTTTGATCCCGGATGCTGGAACACTCAAGGCTCATGGAGAAGAAACTGTGAAGATACCATTGACGTTGATCTATGATGACATCAAGAGCACTTACAACGATATCAACCCCGGGATGATCATACCTTACAGAATCAAGGTTGATCTGATTGTGGATGTGCCAGTATTGGGAAGACTGACATTGCCGCTGGAGAAATGTGGAGAGATCCCAATTCCAAAGAAACCTGATGTTGAT
TRN  10010101100011011
//