EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03136 - DUF245)
FAM  PF03136
PID  DUF245
DES  Putative proteasome component
IPR  IPR004347
ANO  5
ALN  332
AID  0.506976
APH  ((Y2124_MYCBO/128-452:0.13604,Q9RJ61_STRCO/128-453:0.22438):0.76761,(Q9RAW9_9ACTO/164-492:0.16477,O87595_STRCO/155-484:0.17252):0.16409,YTH6_RHOER/1-327:0.25855);
ATP  ((Y2124_MYCBO/128-452,Q9RJ61_STRCO/128-453),(Q9RAW9_9ACTO/164-492,O87595_STRCO/155-484),YTH6_RHOER/1-327);
ATL  1.88796
DNO  5
DLN  996
DID  0.603492
DPH  ((YTH6_RHOER/1-327:0.23238,(Y2124_MYCBO/128-452:0.18774,Q9RJ61_STRCO/128-453:0.18190):0.36595):0.09645,Q9RAW9_9ACTO/164-492:0.12942,O87595_STRCO/155-484:0.15202);
DTP  ((YTH6_RHOER/1-327,(Y2124_MYCBO/128-452,Q9RJ61_STRCO/128-453)),Q9RAW9_9ACTO/164-492,O87595_STRCO/155-484);
DTL  1.34586
RID  0.506976
RPH  ((Y2124_MYCBO/128-452:0.13604,Q9RJ61_STRCO/128-453:0.22438):0.76761,(Q9RAW9_9ACTO/164-492:0.16477,O87595_STRCO/155-484:0.17252):0.16409,YTH6_RHOER/1-327:0.25855);
RTP  ((Y2124_MYCBO/128-452,Q9RJ61_STRCO/128-453),(Q9RAW9_9ACTO/164-492,O87595_STRCO/155-484),YTH6_RHOER/1-327);
RTL  1.88796
LNK  O87595_STRCO/155-484:O87595:AF086832
LNK  Q9RAW9_9ACTO/164-492:Q9RAW9:AF142435
LNK  Q9RJ61_STRCO/128-453:Q9RJ61:AL939109
LNK  Y2124_MYCBO/128-452:P64944:BX248341
LNK  YTH6_RHOER/1-327:P43484:U26421
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9RJ61_STRCO/128-453
ASQ  VARHGEFSRLADILIPFLVTRQLLCGAGKV--LQTPRGAVYCVSQRAEHIWEGVSSATTRSRPIINTRDEPHADAERYRRLHVIVGDSNMSETTMLLKVGATDLVLRMIEAGTVMRDLTLENPIRAIREVSHDITGRRKVRLASGREASALEVQREYYEKAVDFCERRG--IRTGTVERVLELWGRTLDAIEAEDLDRIGTEIDWVMKYKLLERYRAKHNMTMSHPRVAQIDLAYHDIHRRRGLYYLLEKKGQAARVANDLKIFEGKSVPPQTTRARLRGDFIRRAQEQRRDFTVDWVHLKL--NDQAQRTVLCKDPFRSVDDRVEKLIAGM
DSQ  GTGGCCCGGCACGGGGAGTTCTCGCGGCTCGCGGACATCCTCATTCCGTTCCTGGTGACGAGGCAGTTGCTGTGCGGTGCCGGCAAGGTG------CTGCAGACGCCGCGCGGTGCGGTGTACTGCGTCAGCCAGCGGGCGGAGCACATCTGGGAGGGCGTCTCCTCGGCGACGACCCGGTCCCGGCCGATCATCAACACGCGCGACGAGCCGCACGCCGACGCGGAGCGCTACCGGCGTCTGCACGTCATCGTGGGCGACTCGAACATGTCCGAGACGACCATGCTGCTCAAGGTCGGCGCCACCGACCTGGTGCTGCGCATGATCGAGGCGGGCACGGTGATGCGGGACCTGACCCTGGAGAACCCGATCCGGGCGATCCGCGAGGTCAGCCACGACATCACCGGGCGCCGCAAGGTGCGTCTGGCCAGCGGCCGGGAGGCGTCGGCGCTGGAGGTGCAGCGGGAGTACTACGAGAAGGCCGTGGACTTCTGCGAGCGCCGCGGC------ATCCGCACGGGCACCGTGGAGCGGGTGCTGGAGCTGTGGGGCCGCACGCTGGACGCCATCGAGGCCGAGGACCTCGACCGCATCGGCACCGAGATCGACTGGGTCATGAAGTACAAGCTGCTCGAGCGGTACCGGGCCAAGCACAACATGACCATGTCGCACCCGCGGGTCGCGCAGATAGACCTCGCCTACCACGACATCCACCGGCGTCGTGGTCTGTACTACCTGCTGGAGAAGAAGGGCCAGGCGGCCCGGGTCGCCAACGACTTGAAGATCTTCGAGGGCAAGTCCGTTCCGCCGCAGACCACTCGGGCCCGGCTGCGCGGCGACTTCATCCGGCGGGCCCAGGAGCAGCGCCGGGACTTCACCGTCGACTGGGTCCACCTCAAGCTC------AACGACCAGGCGCAGCGCACCGTGTTGTGCAAGGACCCGTTCCGTTCGGTGGACGACCGGGTGGAGAAGCTGATCGCCGGGATG
TRN  10010101100011011
NAM  Y2124_MYCBO/128-452
ASQ  IVRAGEFSRISDVLLPFLVTRQLICGAGKV--LQTPKAATYCLSQRAEHIWEGVSSATTRSRPIINTRDEPHADAEKYRRLHVIVGDSNMSETTTMLKVGTAALVLEMIESGVAFRDFSLDNPIRAIREVSHDVTGRRPVRLAGGRQASALDIQREYYTRAVEHLQTR---EPNAQIEQVVDLWGRQLDAVESQDFAKVDTEIDWVIKRKLFQRYQDRYDMELSHPKIAQLDLAYHDIKRGRGIFDLLQRKGLAARVTTDEEIAEAVDQPPQTTRARLRGEFISAAQEAGRDFTVDWVHLKL--NDQAQRTVLCKDPFRAVDERVKRLIASM
DSQ  ATCGTGCGGGCCGGTGAGTTCTCCCGGATCTCCGACGTGCTGCTGCCCTTCCTGGTCACCCGCCAGCTGATCTGCGGGGCCGGCAAGGTG------CTGCAGACCCCCAAGGCCGCCACCTACTGCTTAAGCCAACGCGCCGAACACATTTGGGAGGGCGTCTCTAGCGCCACGACCCGATCCCGCCCCATTATCAACACCCGCGACGAGCCACATGCCGACGCCGAGAAGTACCGGCGGCTGCACGTCATCGTCGGCGACTCCAACATGTCCGAGACCACCACCATGCTCAAGGTGGGCACCGCGGCGCTCGTGCTGGAAATGATCGAAAGTGGAGTCGCCTTCCGTGATTTTTCCCTGGATAACCCGATCCGCGCCATCCGTGAGGTTAGCCATGATGTCACCGGTCGCCGGCCGGTGCGGTTGGCCGGAGGCCGTCAGGCCAGCGCGCTGGACATCCAGCGGGAGTACTACACCCGCGCAGTCGAGCACTTGCAGACTCGG---------GAGCCCAACGCGCAGATCGAGCAGGTCGTCGACCTGTGGGGCCGCCAACTCGATGCCGTCGAAAGCCAGGATTTCGCCAAGGTCGACACCGAAATCGACTGGGTGATCAAACGCAAGCTGTTTCAGCGTTATCAGGACCGCTATGACATGGAGTTGTCCCACCCGAAGATCGCTCAGCTGGATCTGGCCTACCACGACATCAAGCGCGGACGCGGGATCTTTGATCTCCTGCAGCGCAAAGGGTTGGCCGCGCGCGTCACCACCGACGAAGAAATCGCGGAGGCCGTCGATCAGCCCCCACAGACCACCCGGGCCCGGCTGCGCGGTGAGTTCATCAGCGCCGCGCAGGAGGCGGGACGTGATTTCACCGTCGACTGGGTACATCTCAAACTC------AACGACCAGGCGCAGCGCACCGTGCTGTGCAAAGACCCGTTCCGGGCGGTCGATGAGCGGGTTAAGCGGCTGATCGCGAGCATG
TRN  11011101101011010
NAM  O87595_STRCO/155-484
ASQ  MKRETAFSDIVRHLTPFFVSRQVFTGAGRVGIGQDGHEHGFQLSQRADYFEVEVGLETTLKRPIINTRDEPHADAEKWRRLHVIIGDANLSEISTYLKLGTTALVLSMIEDGFIAVDLAVDQPVRTLHQVSHDPTLKHLVTLRSGRTLTAVQLQMEYYELARKYVEERYGADADDQTKDVLGRWEDTLNRLEN-DPMSLAGELDWVAKRELMEGYRRRDNVDWDAARLHLVDLQYADVRPDKGLYNRLVDRGRIKRLLDENEVERARTKPPEDTRAYFRGRCLEQYADDVAAASWDSVIFDLPGRDSLQR-VPTLEPLRGTRNHVKELLDRC
DSQ  ATGAAGCGGGAAACCGCCTTCTCGGACATCGTGCGCCACCTGACACCCTTCTTCGTCTCCCGCCAGGTCTTCACCGGCGCCGGCCGCGTCGGCATCGGCCAGGACGGCCACGAACACGGCTTCCAGCTCAGCCAGCGCGCCGACTACTTCGAGGTAGAGGTCGGCCTGGAGACGACACTCAAGCGCCCCATCATCAACACCCGCGACGAACCGCACGCCGACGCCGAGAAATGGCGCCGCCTGCACGTGATCATCGGCGACGCGAACCTGTCGGAGATCTCTACCTACCTCAAGCTGGGCACGACGGCCCTGGTCCTCTCCATGATCGAGGACGGCTTCATCGCCGTCGACCTCGCCGTCGACCAGCCCGTACGCACCCTCCACCAGGTCTCGCACGACCCCACGCTCAAGCACCTCGTCACGCTGCGCAGCGGCCGCACACTCACCGCCGTACAGCTCCAGATGGAGTACTACGAGCTGGCCCGCAAGTACGTCGAGGAACGCTACGGCGCGGACGCCGACGACCAGACCAAGGACGTCCTCGGCCGCTGGGAGGACACCCTCAACCGGCTCGAGAAC---GACCCGATGAGCCTGGCCGGCGAACTGGACTGGGTCGCCAAGCGGGAGCTCATGGAGGGCTACCGCCGTCGCGACAACGTCGACTGGGACGCCGCCCGGCTGCACCTCGTCGACCTTCAGTACGCCGACGTACGGCCCGACAAGGGCCTCTACAACCGCCTGGTGGACCGCGGCCGCATCAAGCGCCTGCTGGACGAGAACGAGGTCGAGCGGGCCCGTACGAAGCCGCCGGAGGACACCAGGGCCTACTTCCGCGGGCGCTGCCTGGAGCAGTACGCGGACGACGTCGCGGCGGCCTCCTGGGACTCGGTGATCTTCGATCTGCCGGGCCGGGACTCGCTCCAGCGG---GTGCCAACCCTGGAACCGCTTCGCGGAACGCGTAATCACGTCAAGGAGCTCCTGGACCGCTGC
TRN  10010101100011011
NAM  Q9RAW9_9ACTO/164-492
ASQ  MARSTPFGEIVRNLTPFFVSRQVVCGPGRVGLGVDSREAGFQISQRADFFEVEVGLETTLKRPIINTRDEPHADPEKYRRLHVIIGDANMSEVATYLKVGTTSLVLAMIEDGWFSVDLSVDGPVAALRAISHDPSLKHLVTLRDGRKMTAVQLQMEYFEQARKYVENRFGSDVDPQTADVLSRWESVLGRLEV-DPMSCARKLDWVAKLSILEGYRSRDALAWDSPRLELVDLQYHDVRPDKGLYNRLVERGRFDLVVSEDEVTRAMTEPPEDTRAFFRGRCLARYPQQVAAASWDSVIFDI-GRDSLQR-VPTLEPLRGTRAHVDELLDRC
DSQ  ATGGCCCGCTCGACGCCGTTCGGGGAGATCGTCCGCAACCTCACCCCGTTCTTCGTCTCCCGCCAGGTCGTCTGCGGTCCCGGTCGGGTCGGCCTCGGCGTGGACAGCCGGGAGGCCGGCTTCCAGATCAGCCAGCGGGCGGACTTCTTCGAGGTCGAGGTGGGCCTCGAGACGACGCTGAAGCGCCCGATCATCAACACCCGCGACGAGCCGCACGCCGACCCGGAGAAGTACCGCCGGCTGCACGTCATCATCGGCGACGCGAACATGAGCGAGGTCGCCACCTACCTGAAGGTGGGGACGACGTCGCTGGTTCTCGCCATGATCGAGGACGGCTGGTTCAGCGTCGACCTGTCCGTGGACGGTCCGGTGGCCGCGCTGCGGGCGATCTCGCACGACCCCTCGCTCAAGCATCTCGTCACGTTGCGCGACGGTCGGAAGATGACCGCCGTGCAGCTGCAGATGGAGTACTTCGAGCAGGCCCGCAAGTACGTGGAGAACCGGTTCGGCTCGGACGTCGACCCGCAGACCGCCGACGTCCTCTCCCGGTGGGAGTCGGTCCTCGGCCGCCTCGAGGTC---GACCCGATGAGCTGCGCCCGGAAACTCGACTGGGTCGCCAAGCTGTCGATCCTGGAGGGGTACCGCTCGCGCGACGCCCTGGCCTGGGACTCGCCCCGCCTGGAACTCGTCGACCTGCAGTACCACGACGTCCGGCCGGACAAGGGCCTGTACAACCGCCTCGTCGAGCGCGGCCGGTTCGATCTGGTCGTCAGCGAGGACGAGGTCACCAGGGCGATGACGGAGCCGCCAGAGGACACCCGGGCGTTCTTCCGGGGGCGCTGCCTCGCCCGCTACCCGCAGCAGGTCGCCGCGGCGTCGTGGGACTCGGTGATCTTCGACATC---GGCCGGGACTCCCTGCAGCGG---GTGCCGACCCTGGAGCCGTTGCGGGGGACGAGGGCGCACGTGGACGAGCTGCTCGACCGGTGC
TRN  10010101100011011
NAM  YTH6_RHOER/1-327
ASQ  MSRATPFSAVINGLTPFFASRQVICGSGRVGIGQSGDEAGFQLSQRADYIEVEVGLETTLKRGIINTRDEPHADADKYRRLHVIIGDANLAEMSTYLKVGTTALVLDLIEAGVHLTDLQLARPVTAVHHISHDPTLRATVALADGRELTGLALQRIYLDRVDKFMSAE-GND-DPRVADLLEKWAMVLDLLER-DPMECAHLLDWPAKLRLLEGFRNREGLNWSAPRLHLVDLQYSDVRLDKGLYNRLVARGSMERLVSEQAVLDAVDTPPTDTRAYFRGECLRKFGADIAAASWDSVIFDL-GGDSLVR-IPTLEPLRGSKAHVGKLLESV
DSQ  ATGTCCCGGGCCACGCCGTTCTCGGCGGTGATCAACGGGCTGACGCCGTTCTTCGCGTCCCGTCAGGTGATCTGCGGGTCGGGCCGGGTGGGCATCGGCCAGTCCGGTGACGAGGCCGGCTTCCAGCTGTCCCAGCGGGCCGACTACATCGAGGTGGAGGTCGGGCTCGAGACCACCCTCAAGCGCGGCATCATCAACACCCGCGACGAACCGCACGCGGACGCGGACAAGTACCGGCGCCTGCACGTCATCATCGGCGACGCGAACCTCGCCGAGATGTCGACGTACCTGAAGGTCGGGACGACGGCGCTGGTCCTCGATCTCATCGAGGCCGGTGTACACCTCACCGACCTGCAGCTGGCCCGACCGGTCACCGCCGTGCACCACATCAGCCACGACCCGACGCTGCGCGCCACGGTCGCGCTGGCCGACGGCCGGGAACTGACCGGGCTTGCGTTGCAGCGGATCTACCTGGACCGGGTCGACAAGTTCATGTCCGCCGAG---GGCAACGAC---GACCCCCGCGTGGCCGACCTGCTGGAGAAGTGGGCGATGGTGCTCGACCTCCTCGAGCGG---GACCCGATGGAATGCGCCCATTTGCTGGACTGGCCTGCCAAGCTGCGCCTGCTCGAGGGCTTCCGGAACCGGGAGGGCCTCAACTGGTCCGCACCACGACTGCATCTCGTCGACCTGCAGTACTCGGACGTGCGCCTCGACAAGGGGCTCTACAACCGGCTCGTCGCCCGCGGGTCGATGGAACGCCTGGTGTCGGAGCAGGCGGTGCTCGACGCCGTCGACACCCCGCCGACCGACACCCGCGCCTACTTCCGCGGCGAGTGCCTGCGCAAGTTCGGCGCCGACATTGCGGCTGCGAGCTGGGATTCGGTGATCTTCGATCTC---GGTGGCGACTCCCTGGTCCGC---ATTCCCACCCTGGAGCCGCTGCGGGGCAGCAAGGCGCACGTGGGGAAGCTGCTGGAGTCGGTG
TRN  11011111101111111
//