EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03120 - DNA_ligase_OB)
FAM  PF03120
PID  DNA_ligase_OB
DES  NAD-dependent DNA ligase OB-fold domain
IPR  IPR004150
ANO  25
ALN  88
AID  0.442801
APH  (((((DNLJ_BORBU/314-393:0.97390,(((DNLJ_MYCTU/330-412:0.05259,DNLJ_STRCO/335-417:0.32558):0.23415,DNLJ_HELPJ/312-394:0.59131):0.11830,((DNLJ_RICPR/326-407:0.40625,DNLJ_ZYMMO/348-430:0.34355):0.12387,(DNLJ_ECOLI/320-402:0.23419,(Q9RBF2_ALTHA/320-402:0.19160,DNLJ_HAEIN/330-412:0.15601):0.04120):0.22281):0.05046):0.15472):0.02209,DNLJ_RHOMR/362-444:0.31968):0.07397,(((((Q9YVT0_MSEPV/286-370:0.74328,YICF_ECOLI/310-394:1.48313):0.28355,DNLJ_TREPA/302-381:0.82003):0.24770,DNLJ_THEMA/321-403:0.21196):0.12756,(Q9ZFY2_9DEIN/236-318:0.36545,DNLJ_AQUAE/350-432:0.21113):0.08607):0.05777,(Q9RSQ5_DEIRA/330-412:0.44655,(DNLJ_CHLPN/316-398:0.11541,DNLJ_CHLTR/315-397:0.27102):0.24514):0.17803):0.04701):0.05474,(DNLJ_BACSU/316-398:0.15249,(DNLJ_BACST/315-397:0.14004,(Q99540_HUMAN/327-409:0.28002,DNLJ_SYNY3/319-401:0.23249):0.21249):0.07769):0.09600):0.47067,DNLJ_MYCPN/309-391:0.17018,DNLJ_MYCGE/310-392:0.22340);
ATP  (((((DNLJ_BORBU/314-393,(((DNLJ_MYCTU/330-412,DNLJ_STRCO/335-417),DNLJ_HELPJ/312-394),((DNLJ_RICPR/326-407,DNLJ_ZYMMO/348-430),(DNLJ_ECOLI/320-402,(Q9RBF2_ALTHA/320-402,DNLJ_HAEIN/330-412))))),DNLJ_RHOMR/362-444),(((((Q9YVT0_MSEPV/286-370,YICF_ECOLI/310-394),DNLJ_TREPA/302-381),DNLJ_THEMA/321-403),(Q9ZFY2_9DEIN/236-318,DNLJ_AQUAE/350-432)),(Q9RSQ5_DEIRA/330-412,(DNLJ_CHLPN/316-398,DNLJ_CHLTR/315-397)))),(DNLJ_BACSU/316-398,(DNLJ_BACST/315-397,(Q99540_HUMAN/327-409,DNLJ_SYNY3/319-401)))),DNLJ_MYCPN/309-391,DNLJ_MYCGE/310-392);
ATL  13.0477
DNO  24
DLN  264
DID  0.493913
DPH  (((((((((((DNLJ_CHLPN/316-398:0.19938,DNLJ_CHLTR/315-397:0.23525):0.19901,DNLJ_AQUAE/350-432:0.33865):0.04329,((Q9YVT0_MSEPV/286-370:0.62189,DNLJ_RICPR/326-407:0.34387):0.08919,DNLJ_THEMA/321-403:0.31041):0.11526):0.06860,((DNLJ_ZYMMO/348-430:0.38791,((DNLJ_BORBU/314-393:0.50377,DNLJ_TREPA/302-381:0.58950):0.10802,((DNLJ_ECOLI/320-402:0.30355,Q9RBF2_ALTHA/320-402:0.17115):0.07937,DNLJ_HAEIN/330-412:0.16143):0.09818):0.10585):0.08936,DNLJ_HELPJ/312-394:0.43755):0.07863):0.10615,(DNLJ_MYCPN/309-391:0.21505,DNLJ_MYCGE/310-392:0.27602):0.22527):0.15931,(Q99540_HUMAN/327-409:0.30559,DNLJ_SYNY3/319-401:0.26299):0.07311):0.14213,(DNLJ_BACST/315-397:0.17189,DNLJ_BACSU/316-398:0.19225):0.08093):0.07593,Q9ZFY2_9DEIN/236-318:0.35132):0.07674,Q9RSQ5_DEIRA/330-412:0.34703):0.05247,DNLJ_RHOMR/362-444:0.29816):0.13757,DNLJ_MYCTU/330-412:0.12897,DNLJ_STRCO/335-417:0.19344);
DTP  (((((((((((DNLJ_CHLPN/316-398,DNLJ_CHLTR/315-397),DNLJ_AQUAE/350-432),((Q9YVT0_MSEPV/286-370,DNLJ_RICPR/326-407),DNLJ_THEMA/321-403)),((DNLJ_ZYMMO/348-430,((DNLJ_BORBU/314-393,DNLJ_TREPA/302-381),((DNLJ_ECOLI/320-402,Q9RBF2_ALTHA/320-402),DNLJ_HAEIN/330-412))),DNLJ_HELPJ/312-394)),(DNLJ_MYCPN/309-391,DNLJ_MYCGE/310-392)),(Q99540_HUMAN/327-409,DNLJ_SYNY3/319-401)),(DNLJ_BACST/315-397,DNLJ_BACSU/316-398)),Q9ZFY2_9DEIN/236-318),Q9RSQ5_DEIRA/330-412),DNLJ_RHOMR/362-444),DNLJ_MYCTU/330-412,DNLJ_STRCO/335-417);
DTL  9.58029
RID  0.456937
RPH  ((((((((Q9ZFY2_9DEIN/236-318:0.39264,DNLJ_AQUAE/350-432:0.17657):0.13921,((DNLJ_HELPJ/312-394:0.61361,DNLJ_RICPR/326-407:0.35353):0.02627,((DNLJ_ECOLI/320-402:0.18769,(Q9RBF2_ALTHA/320-402:0.16292,DNLJ_HAEIN/330-412:0.17721):0.11367):0.26007,DNLJ_ZYMMO/348-430:0.30583):0.13208):0.19526):0.00000,DNLJ_RHOMR/362-444:0.32593):0.04963,DNLJ_BORBU/314-393:1.05788):0.03130,(((Q9YVT0_MSEPV/286-370:0.96046,DNLJ_TREPA/302-381:0.78821):0.30429,DNLJ_THEMA/321-403:0.14344):0.19452,(Q9RSQ5_DEIRA/330-412:0.41227,(DNLJ_CHLPN/316-398:0.13216,DNLJ_CHLTR/315-397:0.25680):0.27382):0.17116):0.06549):0.12372,(DNLJ_BACSU/316-398:0.13838,(DNLJ_BACST/315-397:0.13216,(Q99540_HUMAN/327-409:0.27996,DNLJ_SYNY3/319-401:0.23025):0.22892):0.08345):0.06543):0.05639,(DNLJ_MYCTU/330-412:0.11316,DNLJ_STRCO/335-417:0.27156):0.34355):0.40566,DNLJ_MYCPN/309-391:0.15556,DNLJ_MYCGE/310-392:0.24126);
RTP  ((((((((Q9ZFY2_9DEIN/236-318,DNLJ_AQUAE/350-432),((DNLJ_HELPJ/312-394,DNLJ_RICPR/326-407),((DNLJ_ECOLI/320-402,(Q9RBF2_ALTHA/320-402,DNLJ_HAEIN/330-412)),DNLJ_ZYMMO/348-430))),DNLJ_RHOMR/362-444),DNLJ_BORBU/314-393),(((Q9YVT0_MSEPV/286-370,DNLJ_TREPA/302-381),DNLJ_THEMA/321-403),(Q9RSQ5_DEIRA/330-412,(DNLJ_CHLPN/316-398,DNLJ_CHLTR/315-397)))),(DNLJ_BACSU/316-398,(DNLJ_BACST/315-397,(Q99540_HUMAN/327-409,DNLJ_SYNY3/319-401)))),(DNLJ_MYCTU/330-412,DNLJ_STRCO/335-417)),DNLJ_MYCPN/309-391,DNLJ_MYCGE/310-392);
RTL  11.3487
LNK  DNLJ_AQUAE/350-432:O66880:AE000699
LNK  DNLJ_BACST/315-397:O87703:AJ011676
LNK  DNLJ_BACSU/316-398:O31498:Z99107
LNK  DNLJ_BORBU/314-393:O51502:AE001157
LNK  DNLJ_CHLPN/316-398:Q9Z934:AE001601
LNK  DNLJ_CHLTR/315-397:O84148:AE001288
LNK  DNLJ_ECOLI/320-402:P15042:M30255
LNK  DNLJ_HAEIN/330-412:P43813:U32789
LNK  DNLJ_HELPJ/312-394:Q9ZLM1:AE001489
LNK  DNLJ_MYCGE/310-392:P47496:U39704
LNK  DNLJ_MYCPN/309-391:P78021:AE000047
LNK  DNLJ_MYCTU/330-412:P63973:BX842581
LNK  DNLJ_RHOMR/362-444:P49421:U10483
LNK  DNLJ_RICPR/326-407:Q9ZCK9:AJ235273
LNK  DNLJ_STRCO/335-417:Q9Z585:AL939123
LNK  DNLJ_SYNY3/319-401:P72588:D90899
LNK  DNLJ_THEMA/321-403:Q9WXV5:AE001696
LNK  DNLJ_TREPA/302-381:O83642:AE001238
LNK  DNLJ_ZYMMO/348-430:P28719:Z11910
LNK  Q99540_HUMAN/327-409:Q99540:X98266
LNK  Q9RBF2_ALTHA/320-402:Q9RBF2:AF126866
LNK  Q9RSQ5_DEIRA/330-412:Q9RSQ5:AE002043
LNK  Q9YVT0_MSEPV/286-370:Q9YVT0:AF063866
LNK  Q9ZFY2_9DEIN/236-318:Q9ZFY2:AF092868
LNK  YICF_ECOLI/310-394:P25772:
AMK  xxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx..xxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx......xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  YICF_ECOLI/310-394
ASQ  QVAEVKAIQFAVGKSGK.ISVVASLAPVMLDDKKVQRVNIGSVRRWQEWDIAPGDQILVSLAGQGIPRIDDVVWR..GAERTKPTPPE
NAM  DNLJ_TREPA/302-381
ASQ  AITTLRDVQWQT--SGVtYTPIGITDPVRLAGTTVKRANLCNPNMLTKLCLKIGSHVLISKRGEIIPKIEALVS-..-T--PAHAQEI
DSQ  GCGATAACCACCTTGCGTGACGTTCAATGGCAAACA------TCAGGAGTGacgTACACGCCCATTGGTATTACCGATCCAGTGCGCCTTGCAGGAACTACGGTCAAGCGCGCAAATTTATGTAACCCGAATATGCTCACAAAGCTGTGTCTCAAAATTGGCAGCCACGTTTTAATTTCCAAACGGGGGGAGATTATCCCAAAAATTGAAGCACTCGTTTCA---......---ACC------CCAGCACATGCGCAGGAAATC
TRN  10010101100011000
NAM  DNLJ_BORBU/314-393
ASQ  ---RVNSIVVQVGRSGK.ITPVANIDKVFVSGAFITSATLHNQDYIRSIGLNVGDVVKVSRRGDVIPAVEMVIN-..-KFSTGFFKVP
DSQ  ---------AGGGTAAATAGCATTGTTGTTCAGGTTGGACGTAGTGGTAAA...ATTACTCCGGTTGCTAATATTGATAAAGTTTTTGTTTCAGGAGCTTTTATTACTAGTGCAACGTTACACAATCAAGATTATATAAGGTCTATTGGGTTGAATGTTGGTGATGTTGTTAAAGTTTCAAGAAGAGGAGATGTAATTCCTGCTGTTGAAATGGTGATAAAT---......---AAATTTTCAACAGGATTTTTCAAAGTTCCT
TRN  10010101110011000
NAM  DNLJ_HELPJ/312-394
ASQ  KHTKIVGVINQVGRSGA.ITPVALLEPVEIAGAMVNRATLHNYSEIEKKNIMLNDRVVVIRSGDVIPKIIKPLE-..-SYRDGSQQKI
DSQ  AAACACACCAAAATTGTAGGAGTCATTAACCAAGTGGGGCGCAGTGGGGCG...ATCACCCCGGTCGCTCTCTTAGAGCCTGTGGAAATTGCTGGAGCTATGGTTAATAGAGCGACCTTACACAATTATTCTGAAATTGAAAAAAAGAATATCATGCTCAATGATAGGGTGGTCGTCATTAGAAGCGGCGATGTGATCCCTAAAATCATCAAACCTTTAGAA---......---TCTTATAGAGACGGCTCGCAACAAAAAATC
TRN  10010101110011010
NAM  DNLJ_HAEIN/330-412
ASQ  ELTLLNDVEFQVGRTGA.ITPVAKLEPVFVAGVTVSNATLHNGDEIERLNIAIGDTVVIRRAGDVIPQIIGVLH-..-ERRPDNAKPI
DSQ  GAATTAACCCTGTTGAATGATGTTGAATTCCAAGTGGGTCGAACTGGCGCA...ATCACACCAGTTGCCAAATTAGAGCCAGTGTTTGTTGCAGGCGTTACAGTAAGTAATGCCACCTTACATAATGGCGATGAAATTGAACGTTTAAATATCGCTATTGGCGATACTGTTGTTATTCGTCGAGCAGGCGATGTAATTCCACAAATTATTGGCGTATTACAC---......---GAACGTCGCCCTGATAATGCTAAACCAATC
TRN  11011101101011010
NAM  Q9RBF2_ALTHA/320-402
ASQ  EITQLLDVDFQVGRTGA.ITPVARLKPVFVGGVTVSNATLHNSDEVARLGVKVGDTVIIRRAGDVIPQITQVVL-..-ERRPDDARDI
DSQ  GAAATAACCCAATTACTTGATGTTGATTTTCAAGTCGGTCGTACTGGCGCC...ATTACACCGGTTGCACGTTTGAAGCCTGTTTTTGTGGGGGGCGTTACCGTATCAAATGCAACGCTTCATAACAGTGATGAAGTTGCACGTTTGGGCGTCAAAGTAGGTGATACAGTTATTATTCGCCGCGCTGGGGACGTGATCCCGCAAATAACACAAGTTGTACTT---......---GAGCGTCGCCCTGATGATGCCAGAGACATT
TRN  10010101110011000
NAM  DNLJ_ECOLI/320-402
ASQ  QMTFVRDVEFQVGRTGA.ITPVARLEPVHVAGVLVSNATLHNADEIERLGLRIGDKVVIRRAGDVIPQVVNVVL-..-SERPEDTREV
DSQ  CAGATGACCTTTGTGCGTGACGTCGAGTTTCAGGTTGGGCGTACTGGCGCG...ATTACGCCTGTTGCGCGTCTGGAACCTGTCCATGTTGCAGGCGTGCTGGTGAGTAACGCAACCTTACACAATGCGGATGAAATCGAACGTCTTGGTTTACGCATTGGCGATAAAGTGGTGATTCGCCGCGCTGGCGACGTGATCCCGCAGGTGGTTAACGTCGTGCTT---......---TCTGAACGCCCGGAAGATACCCGTGAGGTT
TRN  11011101101011010
NAM  DNLJ_ZYMMO/348-430
ASQ  AQTTLLDIEIQVGRTGV.LTPVAKLEPVTVGGVVVSSATLHNSDEIERLGVRPGDRVLVQRAGDVIPQIVENLT-..-PDVDRPIWHF
DSQ  GCACAAACGACGCTTTTAGATATCGAGATACAGGTTGGGCGTACGGGCGTT...TTGACACCTGTGGCTAAACTAGAGCCTGTCACGGTTGGAGGGGTCGTTGTCTCTTCTGCGACCCTCCATAACTCTGATGAAATTGAGCGTTTGGGTGTCCGTCCGGGAGATCGGGTTCTGGTTCAACGTGCTGGAGATGTTATTCCCCAGATAGTCGAAAATTTAACC---......---CCTGATGTCGATCGTCCGATTTGGCATTTC
TRN  10010101100011010
NAM  DNLJ_RICPR/326-407
ASQ  -QTKLLSITVQVGRTGM.LTPVAELDPIEIGGVVVSRATLHNFQDIARKDVRIKDYVFLQRAGDVIPQITGVDI-..-SKRSNDTVKF
DSQ  ---CAAACAAAGTTACTATCTATTACGGTGCAAGTTGGTAGAACAGGTATG...TTAACGCCTGTAGCAGAGCTTGATCCTATAGAAATAGGTGGGGTAGTTGTTAGTAGAGCAACACTACATAATTTCCAAGATATTGCACGAAAAGATGTGCGGATTAAGGATTATGTATTTTTGCAACGTGCTGGTGATGTTATTCCTCAAATCACAGGTGTTGATATA---......---AGCAAACGTTCCAATGATACGGTAAAGTTT
TRN  10010101110011010
NAM  DNLJ_CHLTR/315-397
ASQ  AETILEDIVVQVGKTGI.LTPVAELAPVFLSGSRVSRASLYNQDEIEKKDIRIGDSVYVEKGGEVIPKIVGINL-..-AKRSLESEPW
DSQ  GCAGAAACGATTTTGGAGGATATTGTCGTTCAAGTAGGGAAAACGGGTATT...CTTACTCCGGTTGCCGAGTTAGCTCCTGTTTTTTTATCTGGGAGCCGCGTGTCCAGAGCATCCTTATACAACCAAGATGAGATTGAAAAAAAAGATATTCGCATCGGAGATTCGGTGTATGTCGAAAAAGGAGGAGAGGTTATTCCCAAAATTGTTGGGATTAATTTG---......---GCTAAGCGTTCATTAGAGAGCGAGCCTTGG
TRN  10010101110011000
NAM  DNLJ_CHLPN/316-398
ASQ  AETLLEDILVQVGRTGV.LTPVAKLTPVLLSGSLVSRASLYNEDEIHRKDIRIGDTVCVAKGGEVIPKVVRVCR-..-EKRPEGSEVW
DSQ  GCAGAGACCCTTCTTGAGGATATTCTAGTTCAAGTAGGAAGAACGGGAGTT...CTGACTCCTGTAGCTAAACTCACTCCTGTACTGTTGTCAGGGTCTTTAGTATCTAGAGCGTCTCTATACAATGAAGATGAGATTCATAGAAAAGACATCCGTATTGGTGATACCGTTTGTGTTGCTAAAGGTGGAGAGGTGATTCCAAAAGTAGTTCGGGTATGCAGA---......---GAAAAACGTCCTGAAGGTTCTGAAGTTTGG
TRN  10010101100011000
NAM  DNLJ_THEMA/321-403
ASQ  ARTRVLDVTIQVGRTGV.LTPVAELEPVQLAGTIVKRASLHNFEYIREKDIRIGDYVFVEKAGGIIPQIVKSIP-..-ELRTGNEKEI
DSQ  GCAAGAACTAGGGTGCTGGATGTCACCATCCAGGTTGGAAGAACAGGTGTT...CTCACACCCGTTGCCGAGCTCGAACCCGTTCAGCTCGCTGGAACGATCGTGAAGAGAGCTTCACTGCACAATTTCGAGTACATAAGAGAAAAAGATATCAGAATAGGAGACTACGTCTTTGTGGAAAAAGCCGGTGGAATCATTCCTCAGATAGTCAAATCGATACCA---......---GAATTGAGAACTGGCAACGAAAAGGAAATA
TRN  10010101100011001
NAM  DNLJ_RHOMR/362-444
ASQ  AITRLLDIMVSVGRTGV.VKPVAVLEPVEVGGVTVSQATLHNEDYVRSRDIRIGDLVVVIRAGDVIPQVVRPVV-..-EARTGNERPW
DSQ  GCCATCACGCGCCTGCTGGACATCATGGTCAGCGTGGGGCGCACCGGCGTG...GTCAAACCGGTGGCCGTGTTGGAGCCGGTCGAAGTCGGCGGTGTGACGGTCTCGCAGGCCACGCTGCACAATGAAGACTACGTGCGCAGCCGCGACATCCGGATCGGCGATCTGGTGGTGGTGATCCGGGCCGGCGACGTGATTCCGCAGGTGGTGCGCCCCGTGGTC---......---GAAGCGCGTACGGGCAACGAGCGCCCCTGG
TRN  11011101101011011
NAM  DNLJ_AQUAE/350-432
ASQ  AVTKLVDVVFQVGRTGT.ITPVGKLEPVELGGVTVSSVSLFNEDFIREKDIRIGDWVVVERAGDVIPYVVEVLK-..-EKRTGEEKPV
DSQ  GCGGTAACAAAACTCGTTGACGTTGTCTTTCAGGTGGGAAGGACGGGAACG...ATTACACCTGTGGGTAAGCTCGAGCCTGTAGAGCTGGGAGGCGTTACCGTTTCTTCTGTATCTCTATTTAACGAAGACTTTATAAGGGAAAAGGACATCAGGATAGGTGACTGGGTGGTAGTTGAGAGGGCTGGAGACGTTATACCTTACGTGGTTGAAGTCTTAAAG---......---GAAAAGAGAACGGGTGAAGAGAAACCCGTG
TRN  10010101100011010
NAM  Q9ZFY2_9DEIN/236-318
ASQ  KETRLLDVVFQVGRTGR.VTPVGILEPVLIEGSEVSRVTLHNESYIEELDIRIGDWVLVHKAGGVIPEVLRVLK-..-ERRTGAERPI
DSQ  AAGGAGACCCGGCTTTTGGACGTGGTCTTCCAGGTGGGGCGCACGGGGCGG...GTGACCCCGGTGGGGATCCTGGAGCCCGTGTTGATAGAGGGGAGCGAGGTGTCCCGGGTCACCCTGCACAACGAAAGCTACATTGAAGAGCTGGACATCCGCATCGGGGACTGGGTCTTGGTCCACAAGGCGGGGGGGGTCATCCCCGAAGTCTTGAGGGTGCTAAAG---......---GAGCGGCGCACCGGGGCGGAGCGGCCCATC
TRN  10010101100011011
NAM  DNLJ_STRCO/335-417
ASQ  VNTKLVDIKVGVGRTGR.VTPYAQVEPVTVAGSEVEFATLHNQEVVKAKGVLIGDTVVLRKAGDVIPEILGPVA-..-DLRDGSEREF
DSQ  GTCAACACCAAGCTGGTCGACATCAAGGTGGGCGTCGGCCGCACCGGCCGC...GTCACGCCGTACGCGCAGGTCGAGCCGGTCACGGTGGCCGGCAGCGAGGTGGAGTTCGCCACCCTGCACAACCAGGAGGTCGTCAAGGCCAAGGGCGTGCTCATCGGCGACACCGTGGTGCTGCGCAAGGCCGGTGACGTGATCCCGGAGATCCTCGGGCCGGTCGCC---......---GACCTCAGGGACGGCAGCGAGCGGGAGTTC
TRN  10010101100011011
NAM  DNLJ_MYCTU/330-412
ASQ  AQTKLLDIRVNVGRTGR.ITPFAFMTPVKVAGSTVGQATLHNASEIKRKGVLIGDTVVIRKAGDVIPEVLGPVV-..-ELRDGSEREF
DSQ  GCGCAGACCAAGCTGCTCGACATCCGGGTGAACGTCGGCCGCACCGGGCGG...ATCACGCCGTTTGCGTTCATGACGCCGGTGAAGGTGGCCGGGTCGACGGTGGGACAGGCCACCCTGCACAACGCCTCGGAGATCAAGCGCAAGGGCGTGCTGATCGGCGACACCGTGGTGATCCGCAAGGCCGGCGACGTGATCCCCGAGGTGCTGGGACCCGTCGTC---......---GAACTGCGCGATGGCTCCGAACGCGAATTC
TRN  11011111101111111
NAM  DNLJ_BACSU/316-398
ASQ  VVTKLLDIELNVGRTGV.ITPTAILEPVKVAGTTVSRASLHNEDLIKEKDIRILDKVVVKKAGDIIPEVVNVLV-..-DQRTGEEKEF
DSQ  GTCGTGACGAAGCTTCTCGATATCGAATTAAATGTCGGCAGAACGGGTGTG...ATTACGCCGACTGCGATTCTTGAGCCGGTAAAAGTTGCCGGCACAACGGTCTCAAGAGCATCCCTTCATAACGAAGATTTAATTAAAGAGAAGGACATTCGGATTTTGGATAAGGTTGTCGTCAAAAAAGCGGGCGATATCATCCCGGAAGTTGTGAATGTCCTCGTT---......---GACCAGCGCACAGGAGAAGAAAAGGAATTC
TRN  10010101110011000
NAM  DNLJ_BACST/315-397
ASQ  VVTTLIGIEVNVGRTGV.VTPTAILEPVRVAGTTVQRATLHNEDFIREKDIRIGDAVIIKKAGDIIPEVVGVVV-..-DRRDGDETPF
DSQ  GTGGTGACGACGTTAATCGGCATTGAGGTGAACGTCGGCCGCACGGGTGTC...GTCACGCCGACGGCGATTTTAGAGCCGGTGCGCGTCGCCGGCACGACGGTGCAGCGCGCCACCCTTCACAATGAAGATTTTATACGGGAAAAAGACATTCGCATCGGCGATGCGGTCATCATTAAAAAAGCGGGCGACATCATCCCGGAAGTGGTCGGCGTCGTCGTT---......---GACCGGCGCGATGGGGATGAAACGCCGTTT
TRN  10010101110011010
NAM  DNLJ_SYNY3/319-401
ASQ  TPTVVKAIEVNVGRTGA.VTPLAVMEPVQLAGTTVQRATLHNQDRIQELDIRVGDTVIIRKAGEIIPEVVRVMT-..-ELRPENTTPY
DSQ  ACCCCCACCGTAGTCAAAGCCATTGAAGTTAATGTGGGCCGCACCGGCGCA...GTCACCCCCCTAGCCGTGATGGAGCCAGTACAGTTAGCCGGCACCACGGTACAAAGAGCCACTCTGCATAACCAAGACCGCATCCAAGAATTAGATATCCGGGTGGGGGACACGGTAATTATTCGCAAAGCAGGGGAAATTATCCCCGAAGTGGTCCGGGTAATGACA---......---GAATTGCGCCCGGAAAACACCACCCCCTAC
TRN  10010101100011010
NAM  Q99540_HUMAN/327-409
ASQ  ALTVVRDIEWTVGRTGA.VTPTAIMDPVQLAGTTVQRASLHNPDYLQQKDIRIGDTVTLHKAGDIIPEVGQVIL-..-SQRPADSIAY
DSQ  GCCTTAACGGTGGTTCGCGATATTGAATGGACCGTGGGTCGGACAGGTGCC...GTCACACCAACGGCTATCATGGATCCTGTTCAACTAGCTGGAACCACAGTGCAACGTGCGAGTTTGCACAATCCTGATTATTTGCAACAAAAAGATATTCGCATCGGGGATACGGTCACGTTGCATAAGGCTGGGGATATTATTCCGGAAGTTGGCCAAGTGATTTTA---......---TCTCAGCGACCAGCCGATAGTATCGCATAT
TRN  11011101111011010
NAM  Q9RSQ5_DEIRA/330-412
ASQ  VETVLESITVNVGRTGK.LAPLAHLSPRLIEGSTVSKATLHNEDYIRDMDLRVGDTVLVRKSGGVIPQIMRVLP-..-DKRPADAAPF
DSQ  GTCGAAACGGTGCTCGAAAGCATCACGGTGAACGTGGGCCGCACCGGCAAA...CTCGCGCCGCTCGCTCACCTGTCGCCCCGGCTGATCGAGGGCAGCACGGTCAGTAAGGCGACCCTGCACAACGAGGACTACATCCGCGATATGGACCTGCGGGTGGGCGACACCGTGCTGGTGCGCAAATCGGGCGGCGTGATTCCCCAGATTATGCGGGTGCTGCCC---......---GACAAGCGCCCGGCGGACGCCGCGCCATTT
TRN  11011101101011011
NAM  DNLJ_MYCGE/310-392
ASQ  VQTKLTAVLITIGRTGR.VNYTAKLESVNLDGTKVTAATLHNFDYIKTKDIRINDTVVIYKAGEIIPKVLKVNL-..-EKRKNDTIII
DSQ  GTTCAAACTAAATTAACAGCAGTTCTTATAACGATTGGTAGAACTGGTAGA...GTGAACTATACTGCTAAATTAGAAAGTGTTAATTTAGATGGAACAAAAGTAACAGCTGCTACTTTACATAACTTTGATTACATTAAAACTAAAGACATTAGGATCAATGACACTGTTGTTATCTATAAAGCTGGGGAAATTATCCCTAAAGTACTAAAGGTAAATCTT---......---GAAAAAAGAAAAAATGACACTATCATAATT
TRN  10010101110011010
NAM  DNLJ_MYCPN/309-391
ASQ  VQTKLRGVLVTVGRTGK.INYTAQLDPVNLEGTVVSAATLHNFDYIKEKDIRLNDTVIIYKAGEIIPKVLEVCL-..-PLRTAANQPI
DSQ  GTCCAAACCAAACTGCGTGGTGTCTTGGTAACAGTGGGACGCACTGGCAAG...ATTAACTATACCGCGCAGTTAGATCCAGTTAACTTAGAGGGGACAGTAGTATCAGCAGCCACACTGCATAACTTTGACTACATTAAGGAGAAGGACATTCGTTTAAACGATACAGTGATAATTTACAAAGCGGGGGAAATTATCCCTAAGGTATTGGAGGTGTGTTTA---......---CCGTTAAGAACAGCAGCGAATCAACCGATT
TRN  10010101100011000
NAM  Q9YVT0_MSEPV/286-370
ASQ  --TKVLNVIWQISKQNK.YIPIAELEPIKLENKTIKRVSCYNAKFVTENGIGTDAIVEIEYRGGAIPKLVNVIKPvtVDESDLPDGKI
DSQ  ------ACTAAAGTTTTAAATGTTATATGGCAAATTTCTAAACAAAATAAA...TATATTCCTATTGCTGAATTAGAACCTATAAAACTTGAAAATAAGACTATAAAAAGAGTTTCATGTTATAATGCAAAATTTGTAACAGAAAATGGTATTGGTACAGATGCAATAGTTGAAATAGAATATAGAGGTGGTGCTATTCCAAAATTAGTAAATGTAATTAAACCAgtaactGTAGATGAATCTGATTTACCAGATGGTAAAATT
TRN  10010101110011000
//